LYN Tyrosine-protein kinase Lyn

• Overview
• Annotations

UniProt Data

Enzyme Annotations (1)

• EC:2.7.10.2 Non-specific protein-tyrosine kinase.
  ATP + a [protein]-L-tyrosine = ADP + a [protein]-L-tyrosine phosphate.

GO Annotations

Cellular component (11)

• GO:0005634 Nucleus
  A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
• GO:0005634 Nucleus
  A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
• GO:0005737 Cytoplasm
  All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
• GO:0005794 Golgi apparatus
  A compound membranous cytoplasmic organelle of eukaryotic cells, consisting of flattened, ribosome-free vesicles arranged in a more or less regular stack. The Golgi apparatus differs from the endoplasmic reticulum in often having slightly thicker membranes, appearing in sections as a characteristic shallow semicircle so that the convex side (cis or entry face) abuts the endoplasmic reticulum, secretory vesicles emerging from the concave side (trans or exit face). In vertebrate cells there is usually one such organelle, while in invertebrates and plants, where they are known usually as dictyosomes, there may be several scattered in the cytoplasm. The Golgi apparatus processes proteins produced on the ribosomes of the rough endoplasmic reticulum; such processing includes modification of the core oligosaccharides of glycoproteins, and the sorting and packaging of proteins for transport to a variety of cellular locations. Three different regions of the Golgi are now recognized both in terms of structure and function: cis, in the vicinity of the cis face, trans, in the vicinity of the trans face, and medial, lying between the cis and trans regions.
• GO:0005829 Cytosol
  The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
• GO:0005886 Plasma membrane
  The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
• GO:0005886 Plasma membrane
  The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
• GO:0043231 Intracellular membrane-bounded organelle
  Organized structure of distinctive morphology and function, bounded by a single or double lipid bilayer membrane and occurring within the cell. Includes the nucleus, mitochondria, plastids, vacuoles, and vesicles. Excludes the plasma membrane.
• GO:0045121 Membrane raft
  Any of the small (10-200 nm), heterogeneous, highly dynamic, sterol- and sphingolipid-enriched membrane domains that compartmentalize cellular processes. Small rafts can sometimes be stabilized to form larger platforms through protein-protein and protein-lipid interactions.
• GO:0048471 Perinuclear region of cytoplasm
  Cytoplasm situated near, or occurring around, the nucleus.
• GO:0070062 Extracellular exosome
  A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.

Molecular function (8)

• GO:0004713 Protein tyrosine kinase activity
  Catalysis of the reaction: ATP + a protein tyrosine = ADP + protein tyrosine phosphate.
• GO:0004713 Protein tyrosine kinase activity
  Catalysis of the reaction: ATP + a protein tyrosine = ADP + protein tyrosine phosphate.
• GO:0004713 Protein tyrosine kinase activity
  Catalysis of the reaction: ATP + a protein tyrosine = ADP + protein tyrosine phosphate.
• GO:0004715 Non-membrane spanning protein tyrosine kinase activity
  Catalysis of the reaction: ATP + protein L-tyrosine = ADP + protein L-tyrosine phosphate by a non-membrane spanning protein.
• GO:0004716 Signal transducer, downstream of receptor, with protein tyrosine kinase activity
  Conveys a signal from an upstream receptor or intracellular signal transducer by catalysis of the reaction: ATP + a protein-L-tyrosine = ADP + a protein-L-tyrosine phosphate.
• GO:0005515 Protein binding
  Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
• GO:0019899 Enzyme binding
  Interacting selectively and non-covalently with any enzyme.
• GO:0044325 Ion channel binding
  Interacting selectively and non-covalently with one or more specific sites on an ion channel, a protein complex that spans a membrane and forms a water-filled channel across the phospholipid bilayer allowing selective ion transport down its electrochemical gradient.

Biological process (55)

• GO:0001782 B cell homeostasis
  The process of regulating the proliferation and elimination of B cells such that the total number of B cells within a whole or part of an organism is stable over time in the absence of an outside stimulus.
• GO:0001817 Regulation of cytokine production
  Any process that modulates the frequency, rate, or extent of production of a cytokine.
• GO:0001932 Regulation of protein phosphorylation
  Any process that modulates the frequency, rate or extent of addition of phosphate groups into an amino acid in a protein.
• GO:0001933 Negative regulation of protein phosphorylation
  Any process that stops, prevents or reduces the rate of addition of phosphate groups to amino acids within a protein.
• GO:0002223 Stimulatory C-type lectin receptor signaling pathway
  Any series of molecular signals generated as a consequence of binding to a C-type lectin receptor capable of cellular activation.
• GO:0002431 Fc receptor mediated stimulatory signaling pathway
  A series of molecular signals generated as a consequence of a the binding of the Fc portion of an immunoglobulin by an Fc receptor capable of activating or perpetuating an immune response. The Fc portion of an immunoglobulin is its C-terminal constant region.
• GO:0002513 Tolerance induction to self antigen
  Tolerance induction directed at self antigens.
• GO:0002513 Tolerance induction to self antigen
  Tolerance induction directed at self antigens.
• GO:0002576 Platelet degranulation
  The regulated exocytosis of secretory granules containing preformed mediators such as histamine and serotonin by a platelet.
• GO:0002768 Immune response-regulating cell surface receptor signaling pathway
  A series of molecular signals initiated by the binding of an extracellular ligand to a receptor on the surface of the target cell capable of activating, perpetuating, or inhibiting an immune response.
• GO:0002768 Immune response-regulating cell surface receptor signaling pathway
  A series of molecular signals initiated by the binding of an extracellular ligand to a receptor on the surface of the target cell capable of activating, perpetuating, or inhibiting an immune response.
• GO:0002774 Fc receptor mediated inhibitory signaling pathway
  A series of molecular signals generated as a consequence of the binding of the Fc portion of an immunoglobulin by an Fc receptor capable of inhibiting an immune effector process contributing to an immune response. The Fc portion of an immunoglobulin is its C-terminal constant region.
• GO:0006468 Protein phosphorylation
  The process of introducing a phosphate group on to a protein.
• GO:0006468 Protein phosphorylation
  The process of introducing a phosphate group on to a protein.
• GO:0006974 Cellular response to DNA damage stimulus
  Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus indicating damage to its DNA from environmental insults or errors during metabolism.
• GO:0007165 Signal transduction
  The cellular process in which a signal is conveyed to trigger a change in the activity or state of a cell. Signal transduction begins with reception of a signal (e.g. a ligand binding to a receptor or receptor activation by a stimulus such as light), or for signal transduction in the absence of ligand, signal-withdrawal or the activity of a constitutively active receptor. Signal transduction ends with regulation of a downstream cellular process, e.g. regulation of transcription or regulation of a metabolic process. Signal transduction covers signaling from receptors located on the surface of the cell and signaling via molecules located within the cell. For signaling between cells, signal transduction is restricted to events at and within the receiving cell.
• GO:0007169 Transmembrane receptor protein tyrosine kinase signaling pathway
  A series of molecular signals initiated by the binding of an extracellular ligand to a receptor on the surface of the target cell where the receptor possesses tyrosine kinase activity, and ending with regulation of a downstream cellular process, e.g. transcription.
• GO:0007596 Blood coagulation
  The sequential process in which the multiple coagulation factors of the blood interact, ultimately resulting in the formation of an insoluble fibrin clot; it may be divided into three stages: stage 1, the formation of intrinsic and extrinsic prothrombin converting principle; stage 2, the formation of thrombin; stage 3, the formation of stable fibrin polymers.
• GO:0008284 Positive regulation of cell proliferation
  Any process that activates or increases the rate or extent of cell proliferation.
• GO:0008285 Negative regulation of cell proliferation
  Any process that stops, prevents or reduces the rate or extent of cell proliferation.
• GO:0009725 Response to hormone
  Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a hormone stimulus.
• GO:0010976 Positive regulation of neuron projection development
  Any process that increases the rate, frequency or extent of neuron projection development. Neuron projection development is the process whose specific outcome is the progression of a neuron projection over time, from its formation to the mature structure. A neuron projection is any process extending from a neural cell, such as axons or dendrites (collectively called neurites).
• GO:0018108 Peptidyl-tyrosine phosphorylation
  The phosphorylation of peptidyl-tyrosine to form peptidyl-O4'-phospho-L-tyrosine.
• GO:0030168 Platelet activation
  A series of progressive, overlapping events triggered by exposure of the platelets to subendothelial tissue. These events include shape change, adhesiveness, aggregation, and release reactions. When carried through to completion, these events lead to the formation of a stable hemostatic plug.
• GO:0030218 Erythrocyte differentiation
  The process in which a myeloid precursor cell acquires specializes features of an erythrocyte.
• GO:0031295 T cell costimulation
  The process of providing, via surface-bound receptor-ligand pairs, a second, antigen-independent, signal in addition to that provided by the T cell receptor to augment T cell activation.
• GO:0031663 Lipopolysaccharide-mediated signaling pathway
  A series of molecular signals initiated by the binding of a lipopolysaccharide (LPS) to a receptor on the surface of a target cell, and ending with regulation of a downstream cellular process, e.g. transcription. Lipopolysaccharides are major components of the outer membrane of Gram-negative bacteria, making them prime targets for recognition by the immune system.
• GO:0033003 Regulation of mast cell activation
  Any process that modulates the frequency, rate, or extent of mast cell activation.
• GO:0033628 Regulation of cell adhesion mediated by integrin
  Any process that modulates the frequency, rate, or extent of cell adhesion mediated by integrin.
• GO:0034136 Negative regulation of toll-like receptor 2 signaling pathway
  Any process that stops, prevents, or reduces the frequency, rate, or extent of toll-like receptor 2 signaling pathway.
• GO:0034144 Negative regulation of toll-like receptor 4 signaling pathway
  Any process that stops, prevents, or reduces the frequency, rate, or extent of toll-like receptor 4 signaling pathway.
• GO:0038095 Fc-epsilon receptor signaling pathway
  A series of molecular signals initiated by the binding of the Fc portion of immunoglobulin E (IgE) to an Fc-epsilon receptor on the surface of a signal-receiving cell, and ending with regulation of a downstream cellular process, e.g. transcription. The Fc portion of an immunoglobulin is its C-terminal constant region.
• GO:0038096 Fc-gamma receptor signaling pathway involved in phagocytosis
  An Fc-gamma receptor signaling pathway that contributes to the endocytic engulfment of external particulate material by phagocytes.
• GO:0042531 Positive regulation of tyrosine phosphorylation of STAT protein
  Any process that activates or increases the frequency, rate or extent of the introduction of a phosphate group to a tyrosine residue of a STAT (Signal Transducer and Activator of Transcription) protein.
• GO:0043304 Regulation of mast cell degranulation
  Any process that modulates the frequency, rate, or extent of mast cell degranulation.
• GO:0043407 Negative regulation of MAP kinase activity
  Any process that stops, prevents, or reduces the frequency, rate or extent of MAP kinase activity.
• GO:0045646 Regulation of erythrocyte differentiation
  Any process that modulates the frequency, rate or extent of erythrocyte differentiation.
• GO:0046777 Protein autophosphorylation
  The phosphorylation by a protein of one or more of its own amino acid residues (cis-autophosphorylation), or residues on an identical protein (trans-autophosphorylation).
• GO:0048013 Ephrin receptor signaling pathway
  The series of molecular signals generated as a consequence of an ephrin receptor binding to an ephrin.
• GO:0050777 Negative regulation of immune response
  Any process that stops, prevents, or reduces the frequency, rate or extent of the immune response, the immunological reaction of an organism to an immunogenic stimulus.
• GO:0050855 Regulation of B cell receptor signaling pathway
  Any process that modulates the frequency, rate or extent of signaling pathways initiated by the cross-linking of an antigen receptor on a B cell.
• GO:0050900 Leukocyte migration
  The movement of a leukocyte within or between different tissues and organs of the body.
• GO:0051272 Positive regulation of cellular component movement
  Any process that activates or increases the frequency, rate or extent of the movement of a cellular component.
• GO:0060397 JAK-STAT cascade involved in growth hormone signaling pathway
  The process in which STAT proteins (Signal Transducers and Activators of Transcription) are activated by members of the JAK (janus activated kinase) family of tyrosine kinases, following the binding of physiological ligands to the growth hormone receptor. Once activated, STATs dimerize and translocate to the nucleus and modulate the expression of target genes.
• GO:0070304 Positive regulation of stress-activated protein kinase signaling cascade
  Any process that activates or increases the frequency, rate or extent of signaling via the stress-activated protein kinase signaling cascade.
• GO:0070372 Regulation of ERK1 and ERK2 cascade
  Any process that modulates the frequency, rate or extent of signal transduction mediated by the ERK1 and ERK2 cascade.
• GO:0070373 Negative regulation of ERK1 and ERK2 cascade
  Any process that stops, prevents, or reduces the frequency, rate or extent of signal transduction mediated by the ERK1 and ERK2 cascade.
• GO:0070667 Negative regulation of mast cell proliferation
  Any process that stops, prevents or reduces the rate or extent of mast cell proliferation.
• GO:0070668 Positive regulation of mast cell proliferation
  Any process that activates or increases the rate or extent of mast cell proliferation.
• GO:0071300 Cellular response to retinoic acid
  Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a retinoic acid stimulus.
• GO:0090025 Regulation of monocyte chemotaxis
  Any process that modulates the frequency, rate, or extent of monocyte chemotaxis.
• GO:0090330 Regulation of platelet aggregation
  Any process that modulates the rate, frequency or extent of platelet aggregation. Platelet aggregation is the adhesion of one platelet to one or more other platelets via adhesion molecules.
• GO:0097028 Dendritic cell differentiation
  The process in which a precursor cell type acquires the specialized features of a dendritic cell. A dendritic cell is a leukocyte of dendritic lineage specialized in the uptake, processing, and transport of antigens to lymph nodes for the purpose of stimulating an immune response via T cell activation.
• GO:1902532 Negative regulation of intracellular signal transduction
  Any process that stops, prevents or reduces the frequency, rate or extent of intracellular signal transduction.
• GO:2000670 Positive regulation of dendritic cell apoptotic process
  Any process that activates or increases the frequency, rate or extent of dendritic cell apoptotic process.

Protein Sequence

>P07948
MGCIKSKGKDSLSDDGVDLKTQPVRNTERTIYVRDPTSNKQQRPVPESQLLPGQRFQTKDPEEQGDIVVALYPYDGIHPD
DLSFKKGEKMKVLEEHGEWWKAKSLLTKKEGFIPSNYVAKLNTLETEEWFFKDITRKDAERQLLAPGNSAGAFLIRESET
LKGSFSLSVRDFDPVHGDVIKHYKIRSLDNGGYYISPRITFPCISDMIKHYQKQADGLCRRLEKACISPKPQKPWDKDAW
EIPRESIKLVKRLGAGQFGEVWMGYYNNSTKVAVKTLKPGTMSVQAFLEEANLMKTLQHDKLVRLYAVVTREEPIYIITE
YMAKGSLLDFLKSDEGGKVLLPKLIDFSAQIAEGMAYIERKNYIHRDLRAANVLVSESLMCKIADFGLARVIEDNEYTAR
EGAKFPIKWTAPEAINFGCFTIKSDVWSFGILLYEIVTYGKIPYPGRTNADVMTALSQGYRMPRVENCPDELYDIMKMCW
KEKAEERPTFDYLQSVLDDFYTATEGQYQQQP