Hck Tyrosine-protein kinase HCK
UniProt Data
Accession | P08103 [ UniProt ] |
Name | HCK_MOUSE |
Description | Tyrosine-protein kinase HCK |
Species | Mus musculus |
Sequence Length | 524 |
Enzyme Annotations (1)
- EC:2.7.10.2 Non-specific protein-tyrosine kinase.
ATP + a [protein]-L-tyrosine = ADP + a [protein]-L-tyrosine phosphate.
GO Annotations
Cellular component (8)
- GO:0005654 Nucleoplasm
That part of the nuclear content other than the chromosomes or the nucleolus. - GO:0005764 Lysosome
A small lytic vacuole that has cell cycle-independent morphology and is found in most animal cells and that contains a variety of hydrolases, most of which have their maximal activities in the pH range 5-6. The contained enzymes display latency if properly isolated. About 40 different lysosomal hydrolases are known and lysosomes have a great variety of morphologies and functions. - GO:0005764 Lysosome
A small lytic vacuole that has cell cycle-independent morphology and is found in most animal cells and that contains a variety of hydrolases, most of which have their maximal activities in the pH range 5-6. The contained enzymes display latency if properly isolated. About 40 different lysosomal hydrolases are known and lysosomes have a great variety of morphologies and functions. - GO:0005886 Plasma membrane
The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins. - GO:0005901 Caveola
A membrane raft that forms small pit, depression, or invagination that communicates with the outside of a cell and extends inward, indenting the cytoplasm and the cell membrane. Examples include flask-shaped invaginations of the plasma membrane in adipocytes associated with caveolin proteins, and minute pits or incuppings of the cell membrane formed during pinocytosis. Caveolae may be pinched off to form free vesicles within the cytoplasm. - GO:0005925 Focal adhesion
Small region on the surface of a cell that anchors the cell to the extracellular matrix and that forms a point of termination of actin filaments. - GO:0031234 Extrinsic component of cytoplasmic side of plasma membrane
The component of a plasma membrane consisting of gene products and protein complexes that are loosely bound to its cytoplasmic surface, but not integrated into the hydrophobic region. - GO:0031234 Extrinsic component of cytoplasmic side of plasma membrane
The component of a plasma membrane consisting of gene products and protein complexes that are loosely bound to its cytoplasmic surface, but not integrated into the hydrophobic region.
Molecular function (4)
- GO:0001784 Phosphotyrosine binding
Interacting selectively and non-covalently with a phosphorylated tyrosine residue within a protein. - GO:0004713 Protein tyrosine kinase activity
Catalysis of the reaction: ATP + a protein tyrosine = ADP + protein tyrosine phosphate. - GO:0004713 Protein tyrosine kinase activity
Catalysis of the reaction: ATP + a protein tyrosine = ADP + protein tyrosine phosphate. - GO:0005515 Protein binding
Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
Biological process (18)
- GO:0006909 Phagocytosis
An endocytosis process that results in the engulfment of external particulate material by phagocytes. The particles are initially contained within phagocytic vacuoles (phagosomes), which then fuse with primary lysosomes to effect digestion of the particles. - GO:0008284 Positive regulation of cell proliferation
Any process that activates or increases the rate or extent of cell proliferation. - GO:0008284 Positive regulation of cell proliferation
Any process that activates or increases the rate or extent of cell proliferation. - GO:0008360 Regulation of cell shape
Any process that modulates the surface configuration of a cell. - GO:0008360 Regulation of cell shape
Any process that modulates the surface configuration of a cell. - GO:0018108 Peptidyl-tyrosine phosphorylation
The phosphorylation of peptidyl-tyrosine to form peptidyl-O4'-phospho-L-tyrosine. - GO:0018108 Peptidyl-tyrosine phosphorylation
The phosphorylation of peptidyl-tyrosine to form peptidyl-O4'-phospho-L-tyrosine. - GO:0043066 Negative regulation of apoptotic process
Any process that stops, prevents, or reduces the frequency, rate or extent of cell death by apoptotic process. - GO:0046777 Protein autophosphorylation
The phosphorylation by a protein of one or more of its own amino acid residues (cis-autophosphorylation), or residues on an identical protein (trans-autophosphorylation). - GO:0046777 Protein autophosphorylation
The phosphorylation by a protein of one or more of its own amino acid residues (cis-autophosphorylation), or residues on an identical protein (trans-autophosphorylation). - GO:0050764 Regulation of phagocytosis
Any process that modulates the frequency, rate or extent of phagocytosis, the process in which phagocytes engulf external particulate material. - GO:0050764 Regulation of phagocytosis
Any process that modulates the frequency, rate or extent of phagocytosis, the process in which phagocytes engulf external particulate material. - GO:0050830 Defense response to Gram-positive bacterium
Reactions triggered in response to the presence of a Gram-positive bacterium that act to protect the cell or organism. - GO:0051090 Regulation of sequence-specific DNA binding transcription factor activity
Any process that modulates the frequency, rate or extent of the activity of a transcription factor, any factor involved in the initiation or regulation of transcription. - GO:0071801 Regulation of podosome assembly
Any process that modulates the frequency, rate or extent of podosome assembly. - GO:0071801 Regulation of podosome assembly
Any process that modulates the frequency, rate or extent of podosome assembly. - GO:2000251 Positive regulation of actin cytoskeleton reorganization
Any process that activates or increases the frequency, rate or extent of actin cytoskeleton reorganization. - GO:2000251 Positive regulation of actin cytoskeleton reorganization
Any process that activates or increases the frequency, rate or extent of actin cytoskeleton reorganization.
Protein Sequence
>P08103 MGGRSSCEDPGCPRSEGRAPRMGCVKSRFLRDGSKASKTEPSANQKGPVYVPDPTSSSKLGPNNSNSMPPGFVEGSEDTI VVALYDYEAIHREDLSFQKGDQMVVLEEAGEWWKARSLATKKEGYIPSNYVARVNSLETEEWFFKGISRKDAERHLLAPG NMLGSFMIRDSETTKGSYSLSVRDFDPQHGDTVKHYKIRTLDSGGFYISPRSTFSSLQELVLHYKKGKDGLCQKLSVPCV SPKPQKPWEKDAWEIPRESLQMEKKLGAGQFGEVWMATYNKHTKVAVKTMKPGSMSVEAFLAEANLMKSLQHDKLVKLHA VVSQEPIFIVTEFMAKGSLLDFLKSEEGSKQPLPKLIDFSAQISEGMAFIEQRNYIHRDLRAANILVSASLVCKIADFGL ARIIEDNEYTAREGAKFPIKWTAPEAINFGSFTIKSDVWSFGILLMEIVTYGRIPYPGMSNPEVIRALEHGYRMPRPDNC PEELYNIMIRCWKNRPEERPTFEYIQSVLDDFYTATESQYQQQP