SRC Proto-oncogene tyrosine-protein kinase Src

• Overview
• Annotations

UniProt Data

Enzyme Annotations (1)

• EC:2.7.10.2 Non-specific protein-tyrosine kinase.
  ATP + a [protein]-L-tyrosine = ADP + a [protein]-L-tyrosine phosphate.

GO Annotations

Cellular component (11)

• GO:0005737 Cytoplasm
  All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
• GO:0005739 Mitochondrion
  A semiautonomous, self replicating organelle that occurs in varying numbers, shapes, and sizes in the cytoplasm of virtually all eukaryotic cells. It is notably the site of tissue respiration.
• GO:0005743 Mitochondrial inner membrane
  The inner, i.e. lumen-facing, lipid bilayer of the mitochondrial envelope. It is highly folded to form cristae.
• GO:0005764 Lysosome
  A small lytic vacuole that has cell cycle-independent morphology and is found in most animal cells and that contains a variety of hydrolases, most of which have their maximal activities in the pH range 5-6. The contained enzymes display latency if properly isolated. About 40 different lysosomal hydrolases are known and lysosomes have a great variety of morphologies and functions.
• GO:0005770 Late endosome
  A prelysosomal endocytic organelle differentiated from early endosomes by lower lumenal pH and different protein composition. Late endosomes are more spherical than early endosomes and are mostly juxtanuclear, being concentrated near the microtubule organizing center.
• GO:0005829 Cytosol
  The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
• GO:0005829 Cytosol
  The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
• GO:0005886 Plasma membrane
  The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
• GO:0005886 Plasma membrane
  The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
• GO:0005901 Caveola
  A membrane raft that forms small pit, depression, or invagination that communicates with the outside of a cell and extends inward, indenting the cytoplasm and the cell membrane. Examples include flask-shaped invaginations of the plasma membrane in adipocytes associated with caveolin proteins, and minute pits or incuppings of the cell membrane formed during pinocytosis. Caveolae may be pinched off to form free vesicles within the cytoplasm.
• GO:0070062 Extracellular exosome
  A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.

Molecular function (23)

• GO:0004672 Protein kinase activity
  Catalysis of the phosphorylation of an amino acid residue in a protein, usually according to the reaction: a protein + ATP = a phosphoprotein + ADP.
• GO:0004672 Protein kinase activity
  Catalysis of the phosphorylation of an amino acid residue in a protein, usually according to the reaction: a protein + ATP = a phosphoprotein + ADP.
• GO:0004713 Protein tyrosine kinase activity
  Catalysis of the reaction: ATP + a protein tyrosine = ADP + protein tyrosine phosphate.
• GO:0004713 Protein tyrosine kinase activity
  Catalysis of the reaction: ATP + a protein tyrosine = ADP + protein tyrosine phosphate.
• GO:0004713 Protein tyrosine kinase activity
  Catalysis of the reaction: ATP + a protein tyrosine = ADP + protein tyrosine phosphate.
• GO:0004713 Protein tyrosine kinase activity
  Catalysis of the reaction: ATP + a protein tyrosine = ADP + protein tyrosine phosphate.
• GO:0004715 Non-membrane spanning protein tyrosine kinase activity
  Catalysis of the reaction: ATP + protein L-tyrosine = ADP + protein L-tyrosine phosphate by a non-membrane spanning protein.
• GO:0005070 SH3/SH2 adaptor activity
  Interacting selectively and non-covalently and simultaneously with one or more signal transduction molecules, usually acting as a scaffold to bring these molecules into close proximity either using their own SH2/SH3 domains (e.g. Grb2) or those of their target molecules (e.g. SAM68).
• GO:0005102 Receptor binding
  Interacting selectively and non-covalently with one or more specific sites on a receptor molecule, a macromolecule that undergoes combination with a hormone, neurotransmitter, drug or intracellular messenger to initiate a change in cell function.
• GO:0005178 Integrin binding
  Interacting selectively and non-covalently with an integrin.
• GO:0005515 Protein binding
  Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
• GO:0008022 Protein C-terminus binding
  Interacting selectively and non-covalently with a protein C-terminus, the end of any peptide chain at which the 1-carboxy function of a constituent amino acid is not attached in peptide linkage to another amino-acid residue.
• GO:0016301 Kinase activity
  Catalysis of the transfer of a phosphate group, usually from ATP, to a substrate molecule.
• GO:0019899 Enzyme binding
  Interacting selectively and non-covalently with any enzyme.
• GO:0019900 Kinase binding
  Interacting selectively and non-covalently with a kinase, any enzyme that catalyzes the transfer of a phosphate group.
• GO:0020037 Heme binding
  Interacting selectively and non-covalently with heme, any compound of iron complexed in a porphyrin (tetrapyrrole) ring.
• GO:0042169 SH2 domain binding
  Interacting selectively and non-covalently with a SH2 domain (Src homology 2) of a protein, a protein domain of about 100 amino-acid residues and belonging to the alpha + beta domain class.
• GO:0044325 Ion channel binding
  Interacting selectively and non-covalently with one or more specific sites on an ion channel, a protein complex that spans a membrane and forms a water-filled channel across the phospholipid bilayer allowing selective ion transport down its electrochemical gradient.
• GO:0045296 Cadherin binding
  Interacting selectively and non-covalently with cadherin, a type I membrane protein involved in cell adhesion.
• GO:0046875 Ephrin receptor binding
  Interacting selectively and non-covalently with an ephrin receptor.
• GO:0051219 Phosphoprotein binding
  Interacting selectively and non-covalently with a phosphorylated protein.
• GO:0070851 Growth factor receptor binding
  Interacting selectively and non-covalently with a growth factor receptor.
• GO:0097110 Scaffold protein binding
  Interacting selectively and non-covalently with a scaffold protein. Scaffold proteins are crucial regulators of many key signaling pathways. Although not strictly defined in function, they are known to interact and/or bind with multiple members of a signaling pathway, tethering them into complexes.

Biological process (51)

• GO:0002223 Stimulatory C-type lectin receptor signaling pathway
  Any series of molecular signals generated as a consequence of binding to a C-type lectin receptor capable of cellular activation.
• GO:0007165 Signal transduction
  The cellular process in which a signal is conveyed to trigger a change in the activity or state of a cell. Signal transduction begins with reception of a signal (e.g. a ligand binding to a receptor or receptor activation by a stimulus such as light), or for signal transduction in the absence of ligand, signal-withdrawal or the activity of a constitutively active receptor. Signal transduction ends with regulation of a downstream cellular process, e.g. regulation of transcription or regulation of a metabolic process. Signal transduction covers signaling from receptors located on the surface of the cell and signaling via molecules located within the cell. For signaling between cells, signal transduction is restricted to events at and within the receiving cell.
• GO:0007172 Signal complex assembly
  The aggregation, arrangement and bonding together of a set of components to form a complex capable of relaying a signal within a cell.
• GO:0007173 Epidermal growth factor receptor signaling pathway
  A series of molecular signals initiated by binding of a ligand to the tyrosine kinase receptor EGFR (ERBB1) on the surface of a cell. The pathway ends with regulation of a downstream cellular process, e.g. transcription.
• GO:0007179 Transforming growth factor beta receptor signaling pathway
  A series of molecular signals initiated by the binding of an extracellular ligand to a transforming growth factor beta receptor on the surface of a target cell, and ending with regulation of a downstream cellular process, e.g. transcription.
• GO:0007229 Integrin-mediated signaling pathway
  A series of molecular signals initiated by the binding of extracellular ligand to an integrin on the surface of a target cell, and ending with regulation of a downstream cellular process, e.g. transcription.
• GO:0007411 Axon guidance
  The chemotaxis process that directs the migration of an axon growth cone to a specific target site in response to a combination of attractive and repulsive cues.
• GO:0010632 Regulation of epithelial cell migration
  Any process that modulates the frequency, rate or extent of epithelial cell migration.
• GO:0010634 Positive regulation of epithelial cell migration
  Any process that activates or increases the frequency, rate or extent of epithelial cell migration.
• GO:0016236 Macroautophagy
  The major inducible pathway for the general turnover of cytoplasmic constituents in eukaryotic cells, it is also responsible for the degradation of active cytoplasmic enzymes and organelles during nutrient starvation. Macroautophagy involves the formation of double-membrane-bounded autophagosomes which enclose the cytoplasmic constituent targeted for degradation in a membrane-bounded structure. Autophagosomes then fuse with a lysosome (or vacuole) releasing single-membrane-bounded autophagic bodies that are then degraded within the lysosome (or vacuole). Though once thought to be a purely non-selective process, it appears that some types of macroautophagy, e.g. macropexophagy, macromitophagy, may involve selective targeting of the targets to be degraded.
• GO:0018108 Peptidyl-tyrosine phosphorylation
  The phosphorylation of peptidyl-tyrosine to form peptidyl-O4'-phospho-L-tyrosine.
• GO:0018108 Peptidyl-tyrosine phosphorylation
  The phosphorylation of peptidyl-tyrosine to form peptidyl-O4'-phospho-L-tyrosine.
• GO:0022407 Regulation of cell-cell adhesion
  Any process that modulates the frequency, rate or extent of attachment of a cell to another cell.
• GO:0030168 Platelet activation
  A series of progressive, overlapping events triggered by exposure of the platelets to subendothelial tissue. These events include shape change, adhesiveness, aggregation, and release reactions. When carried through to completion, these events lead to the formation of a stable hemostatic plug.
• GO:0031295 T cell costimulation
  The process of providing, via surface-bound receptor-ligand pairs, a second, antigen-independent, signal in addition to that provided by the T cell receptor to augment T cell activation.
• GO:0032211 Negative regulation of telomere maintenance via telomerase
  Any process that stops, prevents, or reduces the frequency, rate or extent of the addition of telomeric repeats by telomerase.
• GO:0032463 Negative regulation of protein homooligomerization
  Any process that stops, prevents, or reduces the frequency, rate or extent of protein homooligomerization.
• GO:0033625 Positive regulation of integrin activation
  Any process that activates or increases the frequency, rate, or extent of integrin activation.
• GO:0035556 Intracellular signal transduction
  The process in which a signal is passed on to downstream components within the cell, which become activated themselves to further propagate the signal and finally trigger a change in the function or state of the cell.
• GO:0035556 Intracellular signal transduction
  The process in which a signal is passed on to downstream components within the cell, which become activated themselves to further propagate the signal and finally trigger a change in the function or state of the cell.
• GO:0035635 Entry of bacterium into host cell
  The process in which a bacterium enters a host cell. The host is defined as the larger of the organisms involved in a symbiotic interaction.
• GO:0038096 Fc-gamma receptor signaling pathway involved in phagocytosis
  An Fc-gamma receptor signaling pathway that contributes to the endocytic engulfment of external particulate material by phagocytes.
• GO:0038128 ERBB2 signaling pathway
  A series of molecular signals initiated by binding of a ligand to a member of the ERBB family of receptors on the surface of a cell, where the signal is transmitted by ERBB2. The pathway ends with regulation of a downstream cellular process, e.g. transcription. ERBB2 receptors are themselves unable to bind to ligands, but act as a signal-amplifying tyrosine kinase within a heterodimeric pair.
• GO:0043066 Negative regulation of apoptotic process
  Any process that stops, prevents, or reduces the frequency, rate or extent of cell death by apoptotic process.
• GO:0043114 Regulation of vascular permeability
  Any process that modulates the extent to which blood vessels can be pervaded by fluid.
• GO:0043149 Stress fiber assembly
  The aggregation, arrangement and bonding together of a set of components to form a stress fiber. A stress fiber is a contractile actin filament bundle that consists of short actin filaments with alternating polarity.
• GO:0043154 Negative regulation of cysteine-type endopeptidase activity involved in apoptotic process
  Any process that stops, prevents, or reduces the frequency, rate or extent of a cysteine-type endopeptidase activity involved in the apoptotic process.
• GO:0045124 Regulation of bone resorption
  Any process that modulates the frequency, rate or extent of bone tissue loss (resorption).
• GO:0045453 Bone resorption
  The process in which specialized cells known as osteoclasts degrade the organic and inorganic portions of bone, and endocytose and transport the degradation products.
• GO:0046777 Protein autophosphorylation
  The phosphorylation by a protein of one or more of its own amino acid residues (cis-autophosphorylation), or residues on an identical protein (trans-autophosphorylation).
• GO:0048010 Vascular endothelial growth factor receptor signaling pathway
  Any series of molecular signals initiated by the binding of an extracellular ligand to a vascular endothelial growth factor receptor (VEGFR) located on the surface of the receiving cell, and ending with regulation of a downstream cellular process, e.g. transcription.
• GO:0048013 Ephrin receptor signaling pathway
  The series of molecular signals generated as a consequence of an ephrin receptor binding to an ephrin.
• GO:0050731 Positive regulation of peptidyl-tyrosine phosphorylation
  Any process that activates or increases the frequency, rate or extent of the phosphorylation of peptidyl-tyrosine.
• GO:0050847 Progesterone receptor signaling pathway
  Any series of molecular signals generated as a consequence of a progesterone binding to its receptor.
• GO:0050900 Leukocyte migration
  The movement of a leukocyte within or between different tissues and organs of the body.
• GO:0051057 Positive regulation of small GTPase mediated signal transduction
  Any process that activates or increases the frequency, rate or extent of small GTPase mediated signal transduction.
• GO:0051895 Negative regulation of focal adhesion assembly
  Any process that stops, prevents, or reduces the frequency, rate or extent of focal adhesion assembly, the establishment and maturation of focal adhesions.
• GO:0051897 Positive regulation of protein kinase B signaling
  Any process that activates or increases the frequency, rate or extent of protein kinase B signaling, a series of reactions mediated by the intracellular serine/threonine kinase protein kinase B.
• GO:0051902 Negative regulation of mitochondrial depolarization
  Any process that stops, prevents, or reduces the frequency, rate or extent of the change in the membrane potential of the mitochondria from negative to positive.
• GO:0051974 Negative regulation of telomerase activity
  Any process that stops or reduces the activity of the enzyme telomerase, which catalyzes of the reaction: deoxynucleoside triphosphate + DNA(n) = diphosphate + DNA(n+1).
• GO:0070555 Response to interleukin-1
  Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an interleukin-1 stimulus.
• GO:0071375 Cellular response to peptide hormone stimulus
  Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a peptide hormone stimulus. A peptide hormone is any of a class of peptides that are secreted into the blood stream and have endocrine functions in living animals.
• GO:0071393 Cellular response to progesterone stimulus
  Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a progesterone stimulus.
• GO:0071902 Positive regulation of protein serine/threonine kinase activity
  Any process that increases the rate, frequency, or extent of protein serine/threonine kinase activity.
• GO:0086098 Angiotensin-activated signaling pathway involved in heart process
  An angiotensin receptor signaling pathway which contributes to a circulatory system process carried out by the heart.
• GO:2000394 Positive regulation of lamellipodium morphogenesis
  Any process that activates or increases the frequency, rate or extent of lamellipodium morphogenesis.
• GO:2000641 Regulation of early endosome to late endosome transport
  Any process that modulates the frequency, rate or extent of early endosome to late endosome transport.
• GO:2000811 Negative regulation of anoikis
  Any process that stops, prevents or reduces the frequency, rate or extent of anoikis.
• GO:2001237 Negative regulation of extrinsic apoptotic signaling pathway
  Any process that stops, prevents or reduces the frequency, rate or extent of extrinsic apoptotic signaling pathway.
• GO:2001243 Negative regulation of intrinsic apoptotic signaling pathway
  Any process that stops, prevents or reduces the frequency, rate or extent of intrinsic apoptotic signaling pathway.
• GO:2001286 Regulation of caveolin-mediated endocytosis
  Any process that modulates the frequency, rate or extent of caveolin-mediated endocytosis.

Protein Sequence

>P12931
MGSNKSKPKDASQRRRSLEPAENVHGAGGGAFPASQTPSKPASADGHRGPSAAFAPAAAEPKLFGGFNSSDTVTSPQRAG
PLAGGVTTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLSTGQTGYIPSNYVAPSDSIQAEEWYFGKITRRE
SERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFNSLQQLVAYYSKHADGL
CHRLTTVCPTSKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTRVAIKTLKPGTMSPEAFLQEAQVMKKL
RHEKLVQLYAVVSEEPIYIVTEYMSKGSLLDFLKGETGKYLRLPQLVDMAAQIASGMAYVERMNYVHRDLRAANILVGEN
LVCKVADFGLARLIEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREVLDQVER
GYRMPCPPECPESLHDLMCQCWRKEPEERPTFEYLQAFLEDYFTSTEPQYQPGENL