Genome3D
Saccharomyces cerevisiae S288C

ABP1 Actin-binding protein

UniProt Data

Accession P15891 [ UniProt ]
Name ABP1_YEAST
Description Actin-binding protein
Species Saccharomyces cerevisiae S288C
Sequence Length592

Enzyme Annotations (0)

    GO Annotations

    Cellular component (2)

    • GO:0005938 Cell cortex
      The region of a cell that lies just beneath the plasma membrane and often, but not always, contains a network of actin filaments and associated proteins.
    • GO:0030479 Actin cortical patch
      An endocytic patch that consists of an actin-containing structure found at the plasma membrane in cells; formed of networks of branched actin filaments that lie just beneath the plasma membrane and assemble, move, and disassemble rapidly. An example of this is the actin cortical patch found in Saccharomyces cerevisiae.

    Molecular function (2)

    • GO:0005515 Protein binding
      Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    • GO:0051015 Actin filament binding
      Interacting selectively and non-covalently with an actin filament, also known as F-actin, a helical filamentous polymer of globular G-actin subunits.

    Biological process (4)

    • GO:0000147 Actin cortical patch assembly
      Assembly of an actin cortical patch, a discrete actin-containing structure found at the plasma membrane of fungal cells.
    • GO:0044379 Protein localization to actin cortical patch
      A process in which a protein is transported to, or maintained in, an actin cortical patch.
    • GO:0051016 Barbed-end actin filament capping
      The binding of a protein or protein complex to the barbed (or plus) end of an actin filament, thus preventing the addition, exchange or removal of further actin subunits.
    • GO:2000601 Positive regulation of Arp2/3 complex-mediated actin nucleation
      Any process that activates or increases the frequency, rate or extent of Arp2/3 complex-mediated actin nucleation.

    Protein Sequence

    >P15891
MALEPIDYTTHSREIDAEYLKIVRGSDPDTTWLIISPNAKKEYEPESTGSSFHDFLQLFDETKVQYGLARVSPPGSDVEK
IIIIGWCPDSAPLKTRASFAANFAAVANNLFKGYHVQVTARDEDDLDENELLMKISNAAGARYSIQTSSKQQGKASTPPV
KKSFTPSKSPAPVSKKEPVKTPSPAPAAKISSRVNDNNDDDDWNEPELKERDFDQAPLKPNQSSYKPIGKIDLQKVIAEE
KAKEDPRLVQKPTAAGSKIDPSSDIANLKNESKLKRDSEFNSFLGTTKPPSMTESSLKNDDDKVIKGFRNEKSPAQLWAE
RKAKQNSGNAETKAEAPKPEVPEDEPEGEPDVKDLKSKFEGLAASEKEEEEMENKFAPPPKKSEPTIISPKPFSKPQEPV
KAEEAEQPKTDYKKIGNPLPGMHIEADNEEEPEENDDDWDDDEDEAAQPPLPSRNVASGAPVQKEEPEQEEIAPSLPSRN
SIPAPKQEEAPEQAPEEEIEEEAEEAAPQLPSRSSAAPPPPPRRATPEKKPKENPWATAEYDYDAAEDNELTFVENDKII
NIEFVDDDWWLGELEKDGSKGLFPSNYVSLGN