NCK1 Cytoplasmic protein NCK1

• Overview
• Annotations

UniProt Data

Enzyme Annotations (0)

GO Annotations

Cellular component (8)

• GO:0000164 Protein phosphatase type 1 complex
  A protein complex that possesses magnesium-dependent protein serine/threonine phosphatase (AMD phosphatase) activity, and consists of a catalytic subunit and one or more regulatory subunits that dictates the phosphatase's substrate specificity, function, and activity.
• GO:0005737 Cytoplasm
  All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
• GO:0005737 Cytoplasm
  All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
• GO:0005737 Cytoplasm
  All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
• GO:0005783 Endoplasmic reticulum
  The irregular network of unit membranes, visible only by electron microscopy, that occurs in the cytoplasm of many eukaryotic cells. The membranes form a complex meshwork of tubular channels, which are often expanded into slitlike cavities called cisternae. The ER takes two forms, rough (or granular), with ribosomes adhering to the outer surface, and smooth (with no ribosomes attached).
• GO:0005829 Cytosol
  The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
• GO:0005840 Ribosome
  An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.
• GO:0005886 Plasma membrane
  The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

Molecular function (10)

• GO:0004860 Protein kinase inhibitor activity
  Stops, prevents or reduces the activity of a protein kinase, an enzyme which phosphorylates a protein.
• GO:0005070 SH3/SH2 adaptor activity
  Interacting selectively and non-covalently and simultaneously with one or more signal transduction molecules, usually acting as a scaffold to bring these molecules into close proximity either using their own SH2/SH3 domains (e.g. Grb2) or those of their target molecules (e.g. SAM68).
• GO:0005102 Receptor binding
  Interacting selectively and non-covalently with one or more specific sites on a receptor molecule, a macromolecule that undergoes combination with a hormone, neurotransmitter, drug or intracellular messenger to initiate a change in cell function.
• GO:0005515 Protein binding
  Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
• GO:0008093 Cytoskeletal adaptor activity
  The binding activity of a molecule that brings together a cytoskeletal protein and one or more other molecules, permitting them to function in a coordinated way.
• GO:0030159 Receptor signaling complex scaffold activity
  Functions to provide a physical support for the assembly of a multiprotein receptor signaling complex.
• GO:0030674 Protein binding, bridging
  The binding activity of a molecule that brings together two or more protein molecules, or a protein and another macromolecule or complex, through a selective, non-covalent, often stoichiometric interaction, permitting those molecules to function in a coordinated way.
• GO:0030971 Receptor tyrosine kinase binding
  Interacting selectively and non-covalently with a receptor that possesses protein tyrosine kinase activity.
• GO:0045296 Cadherin binding
  Interacting selectively and non-covalently with cadherin, a type I membrane protein involved in cell adhesion.
• GO:0071074 Eukaryotic initiation factor eIF2 binding
  Interacting selectively and non-covalently with eukaryotic initiation factor eIF2, a protein complex involved in the initiation of ribosome-mediated translation.

Biological process (18)

• GO:0007172 Signal complex assembly
  The aggregation, arrangement and bonding together of a set of components to form a complex capable of relaying a signal within a cell.
• GO:0030838 Positive regulation of actin filament polymerization
  Any process that activates or increases the frequency, rate or extent of actin polymerization.
• GO:0033137 Negative regulation of peptidyl-serine phosphorylation
  Any process that stops, prevents, or reduces the frequency, rate or extent of the phosphorylation of peptidyl-serine.
• GO:0036493 Positive regulation of translation in response to endoplasmic reticulum stress
  Any process that activates, or increases the frequency, rate or extent of translation as a result of endoplasmic reticulum stress.
• GO:0038096 Fc-gamma receptor signaling pathway involved in phagocytosis
  An Fc-gamma receptor signaling pathway that contributes to the endocytic engulfment of external particulate material by phagocytes.
• GO:0042102 Positive regulation of T cell proliferation
  Any process that activates or increases the rate or extent of T cell proliferation.
• GO:0042110 T cell activation
  The change in morphology and behavior of a mature or immature T cell resulting from exposure to a mitogen, cytokine, chemokine, cellular ligand, or an antigen for which it is specific.
• GO:0045944 Positive regulation of transcription from RNA polymerase II promoter
  Any process that activates or increases the frequency, rate or extent of transcription from an RNA polymerase II promoter.
• GO:0048010 Vascular endothelial growth factor receptor signaling pathway
  Any series of molecular signals initiated by the binding of an extracellular ligand to a vascular endothelial growth factor receptor (VEGFR) located on the surface of the receiving cell, and ending with regulation of a downstream cellular process, e.g. transcription.
• GO:0050852 T cell receptor signaling pathway
  A series of molecular signals initiated by the cross-linking of an antigen receptor on a T cell.
• GO:0060548 Negative regulation of cell death
  Any process that decreases the rate or frequency of cell death. Cell death is the specific activation or halting of processes within a cell so that its vital functions markedly cease, rather than simply deteriorating gradually over time, which culminates in cell death.
• GO:0070262 Peptidyl-serine dephosphorylation
  The removal of phosphoric residues from peptidyl-O-phospho-L-serine to form peptidyl-serine.
• GO:1902237 Positive regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway
  Any process that activates or increases the frequency, rate or extent of an endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway.
• GO:1903676 Positive regulation of cap-dependent translational initiation
  Any process that activates or increases the frequency, rate or extent of cap-dependent translational initiation.
• GO:1903679 Positive regulation of cap-independent translational initiation
  Any process that activates or increases the frequency, rate or extent of cap-independent translational initiation.
• GO:1903898 Negative regulation of PERK-mediated unfolded protein response
  Any process that stops, prevents or reduces the frequency, rate or extent of the PERK-mediated unfolded protein response.
• GO:1903912 Negative regulation of endoplasmic reticulum stress-induced eIF2 alpha phosphorylation
  Any process that stops, prevents or reduces the frequency, rate or extent of endoplasmic reticulum stress-induced eiF2alpha phosphorylation.
• GO:1990441 Negative regulation of transcription from RNA polymerase II promoter in response to endoplasmic reticulum stress
  Any process that stops, prevents, or reduces the frequency, rate or extent of transcription from an RNA polymerase II promoter as a result of an endoplasmic reticulum stress.

Protein Sequence

>P16333
MAEEVVVVAKFDYVAQQEQELDIKKNERLWLLDDSKSWWRVRNSMNKTGFVPSNYVERKNSARKASIVKNLKDTLGIGKV
KRKPSVPDSASPADDSFVDPGERLYDLNMPAYVKFNYMAEREDELSLIKGTKVIVMEKCSDGWWRGSYNGQVGWFPSNYV
TEEGDSPLGDHVGSLSEKLAAVVNNLNTGQVLHVVQALYPFSSSNDEELNFEKGDVMDVIEKPENDPEWWKCRKINGMVG
LVPKNYVTVMQNNPLTSGLEPSPPQCDYIRPSLTGKFAGNPWYYGKVTRHQAEMALNERGHEGDFLIRDSESSPNDFSVS
LKAQGKNKHFKVQLKETVYCIGQRKFSTMEELVEHYKKAPIFTSEQGEKLYLVKHLS