Tec Tyrosine-protein kinase Tec

• Overview
• Annotations

UniProt Data

Enzyme Annotations (1)

• EC:2.7.10.2 Non-specific protein-tyrosine kinase.
  ATP + a [protein]-L-tyrosine = ADP + a [protein]-L-tyrosine phosphate.

GO Annotations

Cellular component (4)

• GO:0005829 Cytosol
  The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
• GO:0005856 Cytoskeleton
  Any of the various filamentous elements that form the internal framework of cells, and typically remain after treatment of the cells with mild detergent to remove membrane constituents and soluble components of the cytoplasm. The term embraces intermediate filaments, microfilaments, microtubules, the microtrabecular lattice, and other structures characterized by a polymeric filamentous nature and long-range order within the cell. The various elements of the cytoskeleton not only serve in the maintenance of cellular shape but also have roles in other cellular functions, including cellular movement, cell division, endocytosis, and movement of organelles.
• GO:0005886 Plasma membrane
  The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
• GO:0005911 Cell-cell junction
  A cell junction that forms a connection between two or more cells in a multicellular organism; excludes direct cytoplasmic junctions such as ring canals.

Molecular function (2)

• GO:0004715 Non-membrane spanning protein tyrosine kinase activity
  Catalysis of the reaction: ATP + protein L-tyrosine = ADP + protein L-tyrosine phosphate by a non-membrane spanning protein.
• GO:0005515 Protein binding
  Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).

Biological process (7)

• GO:0007229 Integrin-mediated signaling pathway
  A series of molecular signals initiated by the binding of extracellular ligand to an integrin on the surface of a target cell, and ending with regulation of a downstream cellular process, e.g. transcription.
• GO:0010543 Regulation of platelet activation
  Any process that modulates the rate or frequency of platelet activation. Platelet activation is a series of progressive, overlapping events triggered by exposure of the platelets to subendothelial tissue.
• GO:0018108 Peptidyl-tyrosine phosphorylation
  The phosphorylation of peptidyl-tyrosine to form peptidyl-O4'-phospho-L-tyrosine.
• GO:0038083 Peptidyl-tyrosine autophosphorylation
  The phosphorylation by a protein of one or more of its own tyrosine amino acid residues, or a tyrosine residue on an identical protein.
• GO:0038095 Fc-epsilon receptor signaling pathway
  A series of molecular signals initiated by the binding of the Fc portion of immunoglobulin E (IgE) to an Fc-epsilon receptor on the surface of a signal-receiving cell, and ending with regulation of a downstream cellular process, e.g. transcription. The Fc portion of an immunoglobulin is its C-terminal constant region.
• GO:0050731 Positive regulation of peptidyl-tyrosine phosphorylation
  Any process that activates or increases the frequency, rate or extent of the phosphorylation of peptidyl-tyrosine.
• GO:0050853 B cell receptor signaling pathway
  A series of molecular signals initiated by the cross-linking of an antigen receptor on a B cell.

Protein Sequence

>P24604
MNFNTILEEILIKRSQQKKKTSLLNYKERLCVLPKSVLSYYEGRAEKKYRKGVIDISKIKCVEIVKNDDGVIPCQNKFPF
QVVHDANTLYIFAPSPQSRDRWVKKLKEEIKNNNNIMIKYHPKFWADGSYQCCRQTEKLAPGCEKYNLFESSIRKTLPPA
PEIKKRRPPPPIPPEEENTEEIVVAMYDFQATEAHDLRLERGQEYIILEKNDLHWWRARDKYGSEGYIPSNYVTGKKSNN
LDQYEWYCRNTNRSKAEQLLRTEDKEGGFMVRDSSQPGLYTVSLYTKFGGEGSSGFRHYHIKETATSPKKYYLAEKHAFG
SIPEIIEYHKHNAAGLVTRLRYPVSTKGKNAPTTAGFSYDKWEINPSELTFMRELGSGLFGVVRLGKWRAQYKVAIKAIR
EGAMCEEDFIEEAKVMMKLTHPKLVQLYGVCTQQKPIYIVTEFMERGCLLNFLRQRQGHFSRDMLLSMCQDVCEGMEYLE
RNSFIHRDLAARNCLVNEAGVVKVSDFGMARYVLDDQYTSSSGAKFPVKWCPPEVFNYSRFSSKSDVWSFGVLMWEIFTE
GRMPFEKNTNYEVVTMVTRGHRLHRPKLATKYLYEVMLRCWQERPEGRPSLEDLLRTIDELVECEETFGR