Pik3r1 Phosphatidylinositol 3-kinase regulatory subunit alpha

• Overview
• Annotations

UniProt Data

Enzyme Annotations (0)

GO Annotations

Cellular component (13)

• GO:0005634 Nucleus
  A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
• GO:0005737 Cytoplasm
  All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
• GO:0005737 Cytoplasm
  All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
• GO:0005801 Cis-Golgi network
  The network of interconnected tubular and cisternal structures located at the convex side of the Golgi apparatus, which abuts the endoplasmic reticulum.
• GO:0005829 Cytosol
  The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
• GO:0005829 Cytosol
  The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
• GO:0005911 Cell-cell junction
  A cell junction that forms a connection between two or more cells in a multicellular organism; excludes direct cytoplasmic junctions such as ring canals.
• GO:0005942 Phosphatidylinositol 3-kinase complex
  A protein complex capable of phosphatidylinositol 3-kinase activity and containing subunits of any phosphatidylinositol 3-kinase (PI3K) enzyme. These complexes are divided in three classes (called I, II and III) that differ for their presence across taxonomic groups and for the type of their constituents. Catalytic subunits of phosphatidylinositol 3-kinase enzymes are present in all 3 classes; regulatory subunits of phosphatidylinositol 3-kinase enzymes are present in classes I and III; adaptor proteins have been observed in class II complexes and may be present in other classes too.
• GO:0005943 Phosphatidylinositol 3-kinase complex, class IA
  A class I phosphatidylinositol 3-kinase complex that possesses 1-phosphatidylinositol-4-phosphate 3-kinase activity; comprises a catalytic class IA phosphoinositide 3-kinase (PI3K) subunit and an associated SH2 domain-containing regulatory subunit that is a member of a family of related proteins often called p85 proteins. Through the interaction with the SH2-containing adaptor subunits, Class IA PI3K catalytic subunits are linked to tyrosine kinase signaling pathways.
• GO:0016020 Membrane
  A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
• GO:0016020 Membrane
  A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
• GO:0043234 Protein complex
  A stable macromolecular complex composed (only) of two or more polypeptide subunits along with any covalently attached molecules (such as lipid anchors or oligosaccharide) or non-protein prosthetic groups (such as nucleotides or metal ions). Prosthetic group in this context refers to a tightly bound cofactor. The component polypeptide subunits may be identical.
• GO:1990578 Perinuclear endoplasmic reticulum membrane
  The membrane of the perinuclear endoplasmic reticulum, which is the portion of endoplasmic reticulum, the intracellular network of tubules and cisternae, that occurs near the nucleus.

Molecular function (18)

• GO:0001784 Phosphotyrosine binding
  Interacting selectively and non-covalently with a phosphorylated tyrosine residue within a protein.
• GO:0005158 Insulin receptor binding
  Interacting selectively and non-covalently with the insulin receptor.
• GO:0005158 Insulin receptor binding
  Interacting selectively and non-covalently with the insulin receptor.
• GO:0005159 Insulin-like growth factor receptor binding
  Interacting selectively and non-covalently with the insulin-like growth factor receptor.
• GO:0005159 Insulin-like growth factor receptor binding
  Interacting selectively and non-covalently with the insulin-like growth factor receptor.
• GO:0005168 Neurotrophin TRKA receptor binding
  Interacting selectively and non-covalently with the neurotrophin TRKA receptor.
• GO:0005515 Protein binding
  Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
• GO:0008134 Transcription factor binding
  Interacting selectively and non-covalently with a transcription factor, any protein required to initiate or regulate transcription.
• GO:0008134 Transcription factor binding
  Interacting selectively and non-covalently with a transcription factor, any protein required to initiate or regulate transcription.
• GO:0016303 1-phosphatidylinositol-3-kinase activity
  Catalysis of the reaction: 1-phosphatidyl-1D-myo-inositol + ATP = a 1-phosphatidyl-1D-myo-inositol 3-phosphate + ADP + 2 H(+).
• GO:0019903 Protein phosphatase binding
  Interacting selectively and non-covalently with any protein phosphatase.
• GO:0035014 Phosphatidylinositol 3-kinase regulator activity
  Modulates the activity of any of the phosphatidylinositol 3-kinases (PI3Ks). Regulatory subunits can link a PI3K catalytic subunit to upstream signaling events and help position the catalytic subunits close to their lipid substrates.
• GO:0036312 Phosphatidylinositol 3-kinase regulatory subunit binding
  Interacting selectively and non-covalently with a regulatory subunit of phosphatidylinositol 3-kinase. The regulatory subunit associates with the catalytic subunit to regulate both its activity and subcellular location.
• GO:0043125 ErbB-3 class receptor binding
  Interacting selectively and non-covalently with the protein-tyrosine kinase receptor ErbB-3/HER3.
• GO:0043125 ErbB-3 class receptor binding
  Interacting selectively and non-covalently with the protein-tyrosine kinase receptor ErbB-3/HER3.
• GO:0043559 Insulin binding
  Interacting selectively and non-covalently with insulin, a polypeptide hormone produced by the islets of Langerhans of the pancreas in mammals, and by the homologous organs of other organisms.
• GO:0043560 Insulin receptor substrate binding
  Interacting selectively and non-covalently with any of the insulin receptor substrate (IRS) proteins, adaptor proteins that bind to the transphosphorylated insulin and insulin-like growth factor receptors, are themselves phosphorylated and in turn recruit SH2 domain-containing signaling molecules to form a productive signaling complex.
• GO:0046982 Protein heterodimerization activity
  Interacting selectively and non-covalently with a nonidentical protein to form a heterodimer.

Biological process (43)

• GO:0001678 Cellular glucose homeostasis
  A cellular homeostatic process involved in the maintenance of an internal steady state of glucose within a cell or between a cell and its external environment.
• GO:0001953 Negative regulation of cell-matrix adhesion
  Any process that stops, prevents, or reduces the rate or extent of cell adhesion to the extracellular matrix.
• GO:0006468 Protein phosphorylation
  The process of introducing a phosphate group on to a protein.
• GO:0007162 Negative regulation of cell adhesion
  Any process that stops, prevents, or reduces the frequency, rate or extent of cell adhesion.
• GO:0008286 Insulin receptor signaling pathway
  The series of molecular signals generated as a consequence of the insulin receptor binding to insulin.
• GO:0008625 Extrinsic apoptotic signaling pathway via death domain receptors
  A series of molecular signals in which a signal is conveyed from the cell surface to trigger the apoptotic death of a cell. The pathway starts with a ligand binding to a death domain receptor on the cell surface, and ends when the execution phase of apoptosis is triggered.
• GO:0008625 Extrinsic apoptotic signaling pathway via death domain receptors
  A series of molecular signals in which a signal is conveyed from the cell surface to trigger the apoptotic death of a cell. The pathway starts with a ligand binding to a death domain receptor on the cell surface, and ends when the execution phase of apoptosis is triggered.
• GO:0008630 Intrinsic apoptotic signaling pathway in response to DNA damage
  A series of molecular signals in which an intracellular signal is conveyed to trigger the apoptotic death of a cell. The pathway is induced by the detection of DNA damage, and ends when the execution phase of apoptosis is triggered.
• GO:0008630 Intrinsic apoptotic signaling pathway in response to DNA damage
  A series of molecular signals in which an intracellular signal is conveyed to trigger the apoptotic death of a cell. The pathway is induced by the detection of DNA damage, and ends when the execution phase of apoptosis is triggered.
• GO:0014065 Phosphatidylinositol 3-kinase signaling
  A series of reactions within the signal-receiving cell, mediated by the intracellular phosphatidylinositol 3-kinase (PI3K). Many cell surface receptor linked signaling pathways signal through PI3K to regulate numerous cellular functions.
• GO:0030183 B cell differentiation
  The process in which a precursor cell type acquires the specialized features of a B cell. A B cell is a lymphocyte of B lineage with the phenotype CD19-positive and capable of B cell mediated immunity.
• GO:0030335 Positive regulation of cell migration
  Any process that activates or increases the frequency, rate or extent of cell migration.
• GO:0032760 Positive regulation of tumor necrosis factor production
  Any process that activates or increases the frequency, rate, or extent of tumor necrosis factor production.
• GO:0032869 Cellular response to insulin stimulus
  Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an insulin stimulus. Insulin is a polypeptide hormone produced by the islets of Langerhans of the pancreas in mammals, and by the homologous organs of other organisms.
• GO:0033120 Positive regulation of RNA splicing
  Any process that activates or increases the frequency, rate or extent of RNA splicing.
• GO:0033120 Positive regulation of RNA splicing
  Any process that activates or increases the frequency, rate or extent of RNA splicing.
• GO:0034644 Cellular response to UV
  Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an ultraviolet radiation (UV light) stimulus. Ultraviolet radiation is electromagnetic radiation with a wavelength in the range of 10 to 380 nanometers.
• GO:0034644 Cellular response to UV
  Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an ultraviolet radiation (UV light) stimulus. Ultraviolet radiation is electromagnetic radiation with a wavelength in the range of 10 to 380 nanometers.
• GO:0034976 Response to endoplasmic reticulum stress
  Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stress acting at the endoplasmic reticulum. ER stress usually results from the accumulation of unfolded or misfolded proteins in the ER lumen.
• GO:0034976 Response to endoplasmic reticulum stress
  Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stress acting at the endoplasmic reticulum. ER stress usually results from the accumulation of unfolded or misfolded proteins in the ER lumen.
• GO:0042993 Positive regulation of transcription factor import into nucleus
  Any process that activates or increases the frequency, rate or extent of the movement of a transcription factor from the cytoplasm to the nucleus.
• GO:0042993 Positive regulation of transcription factor import into nucleus
  Any process that activates or increases the frequency, rate or extent of the movement of a transcription factor from the cytoplasm to the nucleus.
• GO:0042993 Positive regulation of transcription factor import into nucleus
  Any process that activates or increases the frequency, rate or extent of the movement of a transcription factor from the cytoplasm to the nucleus.
• GO:0043066 Negative regulation of apoptotic process
  Any process that stops, prevents, or reduces the frequency, rate or extent of cell death by apoptotic process.
• GO:0043066 Negative regulation of apoptotic process
  Any process that stops, prevents, or reduces the frequency, rate or extent of cell death by apoptotic process.
• GO:0045671 Negative regulation of osteoclast differentiation
  Any process that stops, prevents, or reduces the frequency, rate or extent of osteoclast differentiation.
• GO:0045944 Positive regulation of transcription from RNA polymerase II promoter
  Any process that activates or increases the frequency, rate or extent of transcription from an RNA polymerase II promoter.
• GO:0045944 Positive regulation of transcription from RNA polymerase II promoter
  Any process that activates or increases the frequency, rate or extent of transcription from an RNA polymerase II promoter.
• GO:0045944 Positive regulation of transcription from RNA polymerase II promoter
  Any process that activates or increases the frequency, rate or extent of transcription from an RNA polymerase II promoter.
• GO:0046626 Regulation of insulin receptor signaling pathway
  Any process that modulates the frequency, rate or extent of insulin receptor signaling.
• GO:0046854 Phosphatidylinositol phosphorylation
  The process of introducing one or more phosphate groups into a phosphatidylinositol, any glycerophosphoinositol having one phosphatidyl group esterified to one of the hydroxy groups of inositol.
• GO:0048009 Insulin-like growth factor receptor signaling pathway
  The series of molecular signals generated as a consequence of the insulin-like growth factor receptor binding to one of its physiological ligands.
• GO:0048009 Insulin-like growth factor receptor signaling pathway
  The series of molecular signals generated as a consequence of the insulin-like growth factor receptor binding to one of its physiological ligands.
• GO:0048010 Vascular endothelial growth factor receptor signaling pathway
  Any series of molecular signals initiated by the binding of an extracellular ligand to a vascular endothelial growth factor receptor (VEGFR) located on the surface of the receiving cell, and ending with regulation of a downstream cellular process, e.g. transcription.
• GO:0050821 Protein stabilization
  Any process involved in maintaining the structure and integrity of a protein and preventing it from degradation or aggregation.
• GO:0050821 Protein stabilization
  Any process involved in maintaining the structure and integrity of a protein and preventing it from degradation or aggregation.
• GO:0051492 Regulation of stress fiber assembly
  Any process that modulates the frequency, rate or extent of the assembly of a stress fiber, a bundle of microfilaments and other proteins found in fibroblasts.
• GO:0051531 NFAT protein import into nucleus
  The directed movement of NFAT (nuclear factor of activated T cells) proteins, a family of transcription factors, from the cytoplasm into the nucleus. NFAT proteins are dephosphorylated in the cytoplasm by activated calcineurin, which leads to their translocation across the nuclear membrane.
• GO:0060396 Growth hormone receptor signaling pathway
  The series of molecular signals generated as a consequence of growth hormone receptor binding to its physiological ligand.
• GO:0090003 Regulation of establishment of protein localization to plasma membrane
  Any process that modulates the frequency, rate or extent of the directed movement of a protein to a specific location in the plasma membrane.
• GO:1900103 Positive regulation of endoplasmic reticulum unfolded protein response
  Any process that activates or increases the frequency, rate or extent of endoplasmic reticulum unfolded protein response.
• GO:1900103 Positive regulation of endoplasmic reticulum unfolded protein response
  Any process that activates or increases the frequency, rate or extent of endoplasmic reticulum unfolded protein response.
• GO:2001275 Positive regulation of glucose import in response to insulin stimulus
  Any process that activates or increases the frequency, rate or extent of glucose import in response to insulin stimulus.

Protein Sequence

>P26450
MSAEGYQYRALYDYKKEREEDIDLHLGDILTVNKGSLVALGFSDGQEARPEDIGWLNGYNETTGERGDFPGTYVEYIGRK
RISPPTPKPRPPRPLPVAPGSSKTEADTEQQALPLPDLAEQFAPPDVAPPLLIKLLEAIEKKGLECSTLYRTQSSSNPAE
LRQLLDCDAASVDLEMIDVHVLADAFKRYLADLPNPVIPVAVYNEMMSLAQELQSPEDCIQLLKKLIRLPNIPHQCWLTL
QYLLKHFFKLSQASSKNLLNARVLSEIFSPVLFRFPAASSDNTEHLIKAIEILISTEWNERQPAPALPPKPPKPTTVANN
SMNNNMSLQDAEWYWGDISREEVNEKLRDTADGTFLVRDASTKMHGDYTLTLRKGGNNKLIKIFHRDGKYGFSDPLTFNS
VVELINHYRNESLAQYNPKLDVKLLYPVSKYQQDQVVKEDNIEAVGKKLHEYNTQFQEKSREYDRLYEEYTRTSQEIQMK
RTAIEAFNETIKIFEEQCQTQERYSKEYIEKFKREGNEKEIQRIMHNHDKLKSRISEIIDSRRRLEEDLKKQAAEYREID
KRMNSIKPDLIQLRKTRDQYLMWLTQKGVRQKKLNEWLGNENTEDQYSLVEDDEDLPHHDEKTWNVGSSNRNKAENLLRG
KRDGTFLVRESSKQGCYACSVVVDGEVKHCVINKTATGYGFAEPYNLYSSLKELVLHYQHTSLVQHNDSLNVTLAYPVYA
QQRR