csw Tyrosine-protein phosphatase corkscrew

• Overview
• Annotations

UniProt Data

Enzyme Annotations (1)

• EC:3.1.3.48 Protein-tyrosine-phosphatase.
  Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.

GO Annotations

Cellular component (1)

Molecular function (6)

• GO:0004725 Protein tyrosine phosphatase activity
  Catalysis of the reaction: protein tyrosine phosphate + H2O = protein tyrosine + phosphate.
• GO:0004725 Protein tyrosine phosphatase activity
  Catalysis of the reaction: protein tyrosine phosphate + H2O = protein tyrosine + phosphate.
• GO:0004726 Non-membrane spanning protein tyrosine phosphatase activity
  Catalysis of the reaction: non-membrane spanning protein tyrosine phosphate + H2O = non-membrane spanning protein tyrosine + phosphate.
• GO:0004726 Non-membrane spanning protein tyrosine phosphatase activity
  Catalysis of the reaction: non-membrane spanning protein tyrosine phosphate + H2O = non-membrane spanning protein tyrosine + phosphate.
• GO:0004728 Signal transducer, downstream of receptor, with protein tyrosine phosphatase activity
  Conveys a signal from an upstream receptor or intracellular signal transducer by catalysis of the reaction: protein tyrosine phosphate + H2O = protein tyrosine + phosphate.
• GO:0005515 Protein binding
  Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).

Biological process (24)

• GO:0000278 Mitotic cell cycle
  Progression through the phases of the mitotic cell cycle, the most common eukaryotic cell cycle, which canonically comprises four successive phases called G1, S, G2, and M and includes replication of the genome and the subsequent segregation of chromosomes into daughter cells. In some variant cell cycles nuclear replication or nuclear division may not be followed by cell division, or G1 and G2 phases may be absent.
• GO:0006470 Protein dephosphorylation
  The process of removing one or more phosphoric residues from a protein.
• GO:0006470 Protein dephosphorylation
  The process of removing one or more phosphoric residues from a protein.
• GO:0006911 Phagocytosis, engulfment
  The internalization of bacteria, immune complexes and other particulate matter or of an apoptotic cell by phagocytosis, including the membrane and cytoskeletal processes required, which involves one of three mechanisms: zippering of pseudopods around a target via repeated receptor-ligand interactions, sinking of the target directly into plasma membrane of the phagocytosing cell, or induced uptake via an enhanced membrane ruffling of the phagocytosing cell similar to macropinocytosis.
• GO:0007173 Epidermal growth factor receptor signaling pathway
  A series of molecular signals initiated by binding of a ligand to the tyrosine kinase receptor EGFR (ERBB1) on the surface of a cell. The pathway ends with regulation of a downstream cellular process, e.g. transcription.
• GO:0007173 Epidermal growth factor receptor signaling pathway
  A series of molecular signals initiated by binding of a ligand to the tyrosine kinase receptor EGFR (ERBB1) on the surface of a cell. The pathway ends with regulation of a downstream cellular process, e.g. transcription.
• GO:0007362 Terminal region determination
  Specification of the terminal regions (the two non-segmented ends) of the embryo by the gap genes; exemplified in insects by the actions of huckebein and tailless gene products.
• GO:0007418 Ventral midline development
  The process whose specific outcome is the progression of the ventral midline over time, from its formation to the mature structure. In protostomes (such as insects, snails and worms) as well as deuterostomes (vertebrates), the midline is an embryonic region that functions in patterning of the adjacent nervous tissue. The ventral midline in insects is a cell population extending along the ventral surface of the embryo and is the region from which cells detach to form the ventrally located nerve cords. In vertebrates, the midline is originally located dorsally. During development, it folds inwards and becomes the ventral part of the dorsally located neural tube and is then called the ventral midline, or floor plate.
• GO:0007424 Open tracheal system development
  The process whose specific outcome is the progression of an open tracheal system over time, from its formation to the mature structure. An open tracheal system is a respiratory system, a branched network of epithelial tubes that supplies oxygen to target tissues via spiracles. An example of this is found in Drosophila melanogaster.
• GO:0007427 Epithelial cell migration, open tracheal system
  The orderly movement of epithelial cells during development of an open tracheal system. An example of this is found in Drosophila melanogaster.
• GO:0007428 Primary branching, open tracheal system
  Formation of primary branches in the open tracheal system. These form from small groups of cells that migrate out at specific positions, organizing into tubes as they migrate. An example of this is found in Drosophila melanogaster.
• GO:0007444 Imaginal disc development
  The process whose specific outcome is the progression of the imaginal disc over time, from its formation to the metamorphosis to form adult structures. Imaginal discs are epithelial infoldings in the larvae of holometabolous insects that develop into adult structures (legs, antennae, wings, etc.).
• GO:0007465 R7 cell fate commitment
  The process in which the R7 photoreceptor commits to its cell fate. The R7 receptor contributes the central part of the rhabdomere in the apical parts of the ommatidium.
• GO:0007498 Mesoderm development
  The process whose specific outcome is the progression of the mesoderm over time, from its formation to the mature structure. The mesoderm is the middle germ layer that develops into muscle, bone, cartilage, blood and connective tissue.
• GO:0008069 Dorsal/ventral axis specification, ovarian follicular epithelium
  Polarization of the ovarian follicle cells along the dorsal/ventral axis. An example of this process is found in Drosophila melanogaster.
• GO:0008293 Torso signaling pathway
  A series of molecular signals initiated by the binding of an extracellular ligand to torso (a receptor tyrosine kinase) on the surface of a target cell, and ending with regulation of a downstream cellular process, e.g. transcription.
• GO:0008293 Torso signaling pathway
  A series of molecular signals initiated by the binding of an extracellular ligand to torso (a receptor tyrosine kinase) on the surface of a target cell, and ending with regulation of a downstream cellular process, e.g. transcription.
• GO:0008293 Torso signaling pathway
  A series of molecular signals initiated by the binding of an extracellular ligand to torso (a receptor tyrosine kinase) on the surface of a target cell, and ending with regulation of a downstream cellular process, e.g. transcription.
• GO:0008543 Fibroblast growth factor receptor signaling pathway
  The series of molecular signals generated as a consequence of a fibroblast growth factor receptor binding to one of its physiological ligands.
• GO:0008595 Anterior/posterior axis specification, embryo
  The specification of the anterior/posterior axis of the embryo by the products of genes expressed maternally and genes expressed in the zygote.
• GO:0016311 Dephosphorylation
  The process of removing one or more phosphoric (ester or anhydride) residues from a molecule.
• GO:0043066 Negative regulation of apoptotic process
  Any process that stops, prevents, or reduces the frequency, rate or extent of cell death by apoptotic process.
• GO:0045314 Regulation of compound eye photoreceptor development
  Any process that modulates the frequency, rate or extent of compound eye photoreceptor development.
• GO:0045500 Sevenless signaling pathway
  A series of molecular signals initiated by the binding of an extracellular ligand to sevenless (sev; a receptor tyrosine kinase) on the surface of a target cell, and ending with regulation of a downstream cellular process, e.g. transcription.

Protein Sequence

>P29349
MSSRRWFHPTISGIEAEKLLQEQGFDGSFLARLSSSNPGAFTLSVRRGNEVTHIKIQNNGDFFDLYGGEKFATLPELVQY
YMENGELKEKNGQAIELKQPLICAEPTTERWFHGNLSGKEAEKLILERGKNGSFLVRESQSKPGDFVLSVRTDDKVTHVM
IRWQDKKYDVGGGESFGTLSELIDHYKRNPMVETCGTVVHLRQPFNATRITAAGINARVEQLVKGGFWEEFESLQQDSRD
TFSRNEGYKQENRLKNRYRNILPYDHTRVKLLDVEHSVAGAEYINANYIRLPTDGDLYNMSSSSESLNSSVPSCPACTAA
QTQRNCSNCQLQNKTCVQCAVKSAILPYSNCATCSRKSDSLSKHKRSESSASSSPSSGSGSGPGSSGTSGVSSVNGPGTP
TNLTSGTAGCLVGLLKRHSNDSSGAVSISMAEREREREREMFKTYIATQGCLLTQQVNTVTDFWNMVWQENTRVIVMTTK
EYERGKEKCARYWPDEGRSEQFGHARIQCVSENSTSDYTLREFLVSWRDQPARRIFHYHFQVWPDHGVPADPGCVLNFLQ
DVNTRQSHLAQAGEKPGPICVHCSAGIGRTGTFIVIDMILDQIVRNGLDTEIDIQRTIQMVRSQRSGLVQTEAQYKFVYY
AVQHYIQTLIARKRAEEQSLQVGREYTNIKYTGEIGNDSQRSPLPPAISSISLVPSKTPLTPTSADLGTGMGLSMGVGMG
VGNKHASKQQPPLPVVNCNNNNNGIGNSGCSNGGGSSTTSSSNGSSNGNINALLGGIGLGLGGNMRKSNFYSDSLKQQQQ
REEQAPAGAGKMQQPAPPLRPRPGILKLLTSPVIFQQNSKTFPKT