Ptpn6 Tyrosine-protein phosphatase non-receptor type 6
UniProt Data
Accession | P29351 [ UniProt ] |
Name | PTN6_MOUSE |
Description | Tyrosine-protein phosphatase non-receptor type 6 |
Species | Mus musculus |
Sequence Length | 595 |
Enzyme Annotations (1)
- EC:3.1.3.48 Protein-tyrosine-phosphatase.
Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.
GO Annotations
Cellular component (8)
- GO:0005634 Nucleus
A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent. - GO:0005730 Nucleolus
A small, dense body one or more of which are present in the nucleus of eukaryotic cells. It is rich in RNA and protein, is not bounded by a limiting membrane, and is not seen during mitosis. Its prime function is the transcription of the nucleolar DNA into 45S ribosomal-precursor RNA, the processing of this RNA into 5.8S, 18S, and 28S components of ribosomal RNA, and the association of these components with 5S RNA and proteins synthesized outside the nucleolus. This association results in the formation of ribonucleoprotein precursors; these pass into the cytoplasm and mature into the 40S and 60S subunits of the ribosome. - GO:0005737 Cytoplasm
All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures. - GO:0005737 Cytoplasm
All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures. - GO:0005829 Cytosol
The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes. - GO:0005911 Cell-cell junction
A cell junction that forms a connection between two or more cells in a multicellular organism; excludes direct cytoplasmic junctions such as ring canals. - GO:0042105 Alpha-beta T cell receptor complex
A T cell receptor complex in which the TCR heterodimer comprises alpha and beta chains, associated with the CD3 complex; recognizes a complex consisting of an antigen-derived peptide bound to a class I or class II MHC protein. - GO:0070062 Extracellular exosome
A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
Molecular function (10)
- GO:0001784 Phosphotyrosine binding
Interacting selectively and non-covalently with a phosphorylated tyrosine residue within a protein. - GO:0004725 Protein tyrosine phosphatase activity
Catalysis of the reaction: protein tyrosine phosphate + H2O = protein tyrosine + phosphate. - GO:0004725 Protein tyrosine phosphatase activity
Catalysis of the reaction: protein tyrosine phosphate + H2O = protein tyrosine + phosphate. - GO:0005001 Transmembrane receptor protein tyrosine phosphatase activity
Combining with a signal and transmitting the signal from one side of the membrane to the other to initiate a change in cell activity by catalysis of the reaction: protein tyrosine phosphate + H2O = protein tyrosine + phosphate. - GO:0005001 Transmembrane receptor protein tyrosine phosphatase activity
Combining with a signal and transmitting the signal from one side of the membrane to the other to initiate a change in cell activity by catalysis of the reaction: protein tyrosine phosphate + H2O = protein tyrosine + phosphate. - GO:0005515 Protein binding
Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules). - GO:0017124 SH3 domain binding
Interacting selectively and non-covalently with a SH3 domain (Src homology 3) of a protein, small protein modules containing approximately 50 amino acid residues found in a great variety of intracellular or membrane-associated proteins. - GO:0019901 Protein kinase binding
Interacting selectively and non-covalently with a protein kinase, any enzyme that catalyzes the transfer of a phosphate group, usually from ATP, to a protein substrate. - GO:0042169 SH2 domain binding
Interacting selectively and non-covalently with a SH2 domain (Src homology 2) of a protein, a protein domain of about 100 amino-acid residues and belonging to the alpha + beta domain class. - GO:0050839 Cell adhesion molecule binding
Interacting selectively and non-covalently with a cell adhesion molecule.
Biological process (35)
- GO:0002244 Hematopoietic progenitor cell differentiation
The process in which precursor cell type acquires the specialized features of a hematopoietic progenitor cell, a class of cell types including myeloid progenitor cells and lymphoid progenitor cells. - GO:0002924 Negative regulation of humoral immune response mediated by circulating immunoglobulin
Any process that stops, prevents, or reduces the frequency, rate, or extent of a humoral immune response mediated by circulating immunoglobulin. - GO:0006470 Protein dephosphorylation
The process of removing one or more phosphoric residues from a protein. - GO:0006470 Protein dephosphorylation
The process of removing one or more phosphoric residues from a protein. - GO:0006470 Protein dephosphorylation
The process of removing one or more phosphoric residues from a protein. - GO:0008283 Cell proliferation
The multiplication or reproduction of cells, resulting in the expansion of a cell population. - GO:0008283 Cell proliferation
The multiplication or reproduction of cells, resulting in the expansion of a cell population. - GO:0008284 Positive regulation of cell proliferation
Any process that activates or increases the rate or extent of cell proliferation. - GO:0014068 Positive regulation of phosphatidylinositol 3-kinase signaling
Any process that activates or increases the frequency, rate or extent of signal transduction mediated by the phosphatidylinositol 3-kinase cascade. - GO:0018108 Peptidyl-tyrosine phosphorylation
The phosphorylation of peptidyl-tyrosine to form peptidyl-O4'-phospho-L-tyrosine. - GO:0019221 Cytokine-mediated signaling pathway
A series of molecular signals initiated by the binding of a cytokine to a receptor on the surface of a cell, and ending with regulation of a downstream cellular process, e.g. transcription. - GO:0030154 Cell differentiation
The process in which relatively unspecialized cells, e.g. embryonic or regenerative cells, acquire specialized structural and/or functional features that characterize the cells, tissues, or organs of the mature organism or some other relatively stable phase of the organism's life history. Differentiation includes the processes involved in commitment of a cell to a specific fate and its subsequent development to the mature state. - GO:0030154 Cell differentiation
The process in which relatively unspecialized cells, e.g. embryonic or regenerative cells, acquire specialized structural and/or functional features that characterize the cells, tissues, or organs of the mature organism or some other relatively stable phase of the organism's life history. Differentiation includes the processes involved in commitment of a cell to a specific fate and its subsequent development to the mature state. - GO:0030220 Platelet formation
The process in which platelets bud from long processes extended by megakaryocytes. - GO:0033277 Abortive mitotic cell cycle
A cell cycle in which mitosis is begun and progresses normally through the end of anaphase, but not completed, resulting in a cell with increased ploidy. - GO:0033630 Positive regulation of cell adhesion mediated by integrin
Any process that activates or increases the frequency, rate, or extent of cell adhesion mediated by integrin. - GO:0035556 Intracellular signal transduction
The process in which a signal is passed on to downstream components within the cell, which become activated themselves to further propagate the signal and finally trigger a change in the function or state of the cell. - GO:0035855 Megakaryocyte development
The process whose specific outcome is the progression of a megakaryocyte cell over time, from its formation to the mature structure. Megakaryocyte development does not include the steps involved in committing a cell to a megakaryocyte fate. A megakaryocyte is a giant cell 50 to 100 micron in diameter, with a greatly lobulated nucleus, found in the bone marrow. - GO:0042130 Negative regulation of T cell proliferation
Any process that stops, prevents or reduces the rate or extent of T cell proliferation. - GO:0042267 Natural killer cell mediated cytotoxicity
The directed killing of a target cell by a natural killer cell through the release of granules containing cytotoxic mediators or through the engagement of death receptors. - GO:0043407 Negative regulation of MAP kinase activity
Any process that stops, prevents, or reduces the frequency, rate or extent of MAP kinase activity. - GO:0043409 Negative regulation of MAPK cascade
Any process that stops, prevents, or reduces the frequency, rate or extent of signal transduction mediated by the MAPKKK cascade. - GO:0045577 Regulation of B cell differentiation
Any process that modulates the frequency, rate or extent of B cell differentiation. - GO:0050732 Negative regulation of peptidyl-tyrosine phosphorylation
Any process that stops, prevents, or reduces the frequency, rate or extent of the phosphorylation of peptidyl-tyrosine. - GO:0050732 Negative regulation of peptidyl-tyrosine phosphorylation
Any process that stops, prevents, or reduces the frequency, rate or extent of the phosphorylation of peptidyl-tyrosine. - GO:0050853 B cell receptor signaling pathway
A series of molecular signals initiated by the cross-linking of an antigen receptor on a B cell. - GO:0050859 Negative regulation of B cell receptor signaling pathway
Any process that stops, prevents, or reduces the frequency, rate or extent of signaling pathways initiated by the cross-linking of an antigen receptor on a B cell. - GO:0050860 Negative regulation of T cell receptor signaling pathway
Any process that stops, prevents, or reduces the frequency, rate or extent of signaling pathways initiated by the cross-linking of an antigen receptor on a T cell. - GO:0051279 Regulation of release of sequestered calcium ion into cytosol
Any process that modulates the frequency, rate or extent of the release into the cytosolic compartment of calcium ions sequestered in the endoplasmic reticulum or mitochondria. - GO:0060334 Regulation of interferon-gamma-mediated signaling pathway
Any process that modulates the rate, frequency or extent of the series of molecular events generated as a consequence of interferon-gamma binding to a cell surface receptor. - GO:0060397 JAK-STAT cascade involved in growth hormone signaling pathway
The process in which STAT proteins (Signal Transducers and Activators of Transcription) are activated by members of the JAK (janus activated kinase) family of tyrosine kinases, following the binding of physiological ligands to the growth hormone receptor. Once activated, STATs dimerize and translocate to the nucleus and modulate the expression of target genes. - GO:0070372 Regulation of ERK1 and ERK2 cascade
Any process that modulates the frequency, rate or extent of signal transduction mediated by the ERK1 and ERK2 cascade. - GO:0070372 Regulation of ERK1 and ERK2 cascade
Any process that modulates the frequency, rate or extent of signal transduction mediated by the ERK1 and ERK2 cascade. - GO:0070527 Platelet aggregation
The adhesion of one platelet to one or more other platelets via adhesion molecules. - GO:2000045 Regulation of G1/S transition of mitotic cell cycle
Any cell cycle regulatory process that controls the commitment of a cell from G1 to S phase of the mitotic cell cycle.
Protein Sequence
>P29351 MVRWFHRDLSGPDAETLLKGRGVPGSFLARPSRKNQGDFSLSVRVDDQVTHIRIQNSGDFYDLYGGEKFATLTELVEYYT QQQGILQDRDGTIIHLKYPLNCSDPTSERWYHGHISGGQAESLLQAKGEPWTFLVRESLSQPGDFVLSVLNDQPKAGPGS PLRVTHIKVMCEGGRYTVGGSETFDSLTDLVEHFKKTGIEEASGAFVYLRQPYYATRVNAADIENRVLELNKKQESEDTA KAGFWEEFESLQKQEVKNLHQRLEGQRPENKSKNRYKNILPFDHSRVILQGRDSNIPGSDYINANYVKNQLLGPDENSKT YIASQGCLDATVNDFWQMAWQENTRVIVMTTREVEKGRNKCVPYWPEVGTQRVYGLYSVTNSREHDTAEYKLRTLQISPL DNGDLVREIWHYQYLSWPDHGVPSEPGGVLSFLDQINQRQESLPHAGPIIVHCSAGIGRTGTIIVIDMLMESISTKGLDC DIDIQKTIQMVRAQRSGMVQTEAQYKFIYVAIAQFIETTKKKLEIIQSQKGQESEYGNITYPPAVRSAHAKASRTSSKHK EEVYENVHSKSKKEEKVKKQRSADKEKNKGSLKRK