Genome3D
Caenorhabditis elegans

sem-5 Sex muscle abnormal protein 5

UniProt Data

Accession P29355 [ UniProt ]
Name SEM5_CAEEL
Description Sex muscle abnormal protein 5
Species Caenorhabditis elegans
Sequence Length228

Enzyme Annotations (0)

    GO Annotations

    Cellular component (1)

    None predicted

    Molecular function (3)

    • GO:0005070 SH3/SH2 adaptor activity
      Interacting selectively and non-covalently and simultaneously with one or more signal transduction molecules, usually acting as a scaffold to bring these molecules into close proximity either using their own SH2/SH3 domains (e.g. Grb2) or those of their target molecules (e.g. SAM68).
    • GO:0005154 Epidermal growth factor receptor binding
      Interacting selectively and non-covalently with the epidermal growth factor receptor.
    • GO:0005515 Protein binding
      Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).

    Biological process (6)

    • GO:0002119 Nematode larval development
      The process whose specific outcome is the progression of the nematode larva over time, from its formation to the mature structure. Nematode larval development begins with the newly hatched first-stage larva (L1) and ends with the end of the last larval stage (for example the fourth larval stage (L4) in C. elegans). Each stage of nematode larval development is characterized by proliferation of specific cell lineages and an increase in body size without alteration of the basic body plan. Nematode larval stages are separated by molts in which each stage-specific exoskeleton, or cuticle, is shed and replaced anew.
    • GO:0007517 Muscle organ development
      The process whose specific outcome is the progression of the muscle over time, from its formation to the mature structure. The muscle is an organ consisting of a tissue made up of various elongated cells that are specialized to contract and thus to produce movement and mechanical work.
    • GO:0016477 Cell migration
      The controlled self-propelled movement of a cell from one site to a destination guided by molecular cues. Cell migration is a central process in the development and maintenance of multicellular organisms.
    • GO:0030539 Male genitalia development
      The process whose specific outcome is the progression of the male genitalia over time, from its formation to the mature structure.
    • GO:0031344 Regulation of cell projection organization
      Any process that modulates the frequency, rate or extent of a process involved in the formation, arrangement of constituent parts, or disassembly of cell projections.
    • GO:0040028 Regulation of vulval development
      Any process that modulates the frequency, rate or extent of development of the vulva. Vulval development is the process whose specific outcome is the progression of the egg-laying organ of female and hermaphrodite nematodes over time, from its formation to the mature structure. In nematodes, the vulva is formed from ventral epidermal cells during larval stages to give rise to a fully formed vulva in the adult.

    Protein Sequence

    >P29355
MEAVAEHDFQAGSPDELSFKRGNTLKVLNKDEDPHWYKAELDGNEGFIPSNYIRMTECNWYLGKITRNDAEVLLKKPTVR
DGHFLVRQCESSPGEFSISVRFQDSVQHFKVLRDQNGKYYLWAVKFNSLNELVAYHRTASVSRTHTILLSDMNVETKFVQ
ALFDFNPQESGELAFKRGDVITLINKDDPNWWEGQLNNRRGIFPSNYVCPYNSNKSNSNVAPGFNFGN