Genome3D
Saccharomyces cerevisiae S288C

BEM1 Bud emergence protein 1

UniProt Data

Accession P29366 [ UniProt ]
Name BEM1_YEAST
Description Bud emergence protein 1
Species Saccharomyces cerevisiae S288C
Sequence Length551

Enzyme Annotations (0)

    GO Annotations

    Cellular component (4)

    • GO:0000131 Incipient cellular bud site
      The portion of the budding yeast plasma membrane where a daughter cell will emerge. The yeast marks this spot with bud-site selection proteins before bud emergence occurs. Actin is polarized to this spot just prior to and during bud emergence.
    • GO:0005934 Cellular bud tip
      The end of a cellular bud distal to the site of attachment to the mother cell.
    • GO:0005935 Cellular bud neck
      The constriction between the mother cell and daughter cell (bud) in an organism that reproduces by budding.
    • GO:0030427 Site of polarized growth
      Any part of a cell where non-isotropic growth takes place.

    Molecular function (3)

    • GO:0005515 Protein binding
      Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    • GO:0032266 Phosphatidylinositol-3-phosphate binding
      Interacting selectively and non-covalently with phosphatidylinositol-3-phosphate, a derivative of phosphatidylinositol in which the inositol ring is phosphorylated at the 3' position.
    • GO:0032947 Protein complex scaffold
      A structural molecule activity that provides a physical support for the assembly of a multiprotein complex. The scaffold may or may not be part of the final complex.

    Biological process (2)

    • GO:0000753 Cell morphogenesis involved in conjugation with cellular fusion
      The change in form (cell shape and size) that occurs during sexual reproduction in order to facilitate direct contact between the compatible mating types in organisms that undergo conjugation cellular fusion.
    • GO:0000753 Cell morphogenesis involved in conjugation with cellular fusion
      The change in form (cell shape and size) that occurs during sexual reproduction in order to facilitate direct contact between the compatible mating types in organisms that undergo conjugation cellular fusion.

    Protein Sequence

    >P29366
MLKNFKLSKRDSNGSKGRITSADISTPSHDNGSVIKHIKTVPVRYLSSSSTPVKSQRDSSPKNRHNSKDITSPEKVIKAK
YSYQAQTSKELSFMEGEFFYVSGDEKDWYKASNPSTGKEGVVPKTYFEVFDRTKPSSVNGSNSSSRKVTNDSLNMGSLYA
IVLYDFKAEKADELTTYVGENLFICAHHNCEWFIAKPIGRLGGPGLVPVGFVSIIDIATGYATGNDVIEDIKSVNLPTVQ
EWKSNIARYKASNISLGSVEQQQQQSITKPQNKSAKLVDGELLVKASVESFGLEDEKYWFLVCCELSNGKTRQLKRYYQD
FYDLQVQLLDAFPAEAGKLRDAGGQWSKRIMPYIPGPVPYVTNSITKKRKEDLNIYVADLVNLPDYISRSEMVHSLFVVL
NNGFDREFERDENQNNIKTLQENDTATFATASQTSNFASTNQDNTLTGEDLKLNKKLSDLSLSGSKQAPAQSTSGLKTTK
IKFYYKDDIFALMLKGDTTYKELRSKIAPRIDTDNFKLQTKLFDGSGEEIKTDSQVSNIIQAKLKISVHDI