Ptpn11 Tyrosine-protein phosphatase non-receptor type 11

• Overview
• Annotations

UniProt Data

Enzyme Annotations (1)

• EC:3.1.3.48 Protein-tyrosine-phosphatase.
  Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.

GO Annotations

Cellular component (5)

• GO:0005634 Nucleus
  A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
• GO:0005634 Nucleus
  A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
• GO:0005737 Cytoplasm
  All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
• GO:0005737 Cytoplasm
  All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
• GO:0005829 Cytosol
  The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.

Molecular function (12)

• GO:0004721 Phosphoprotein phosphatase activity
  Catalysis of the reaction: a phosphoprotein + H2O = a protein + phosphate. Together with protein kinases, these enzymes control the state of phosphorylation of cell proteins and thereby provide an important mechanism for regulating cellular activity.
• GO:0004721 Phosphoprotein phosphatase activity
  Catalysis of the reaction: a phosphoprotein + H2O = a protein + phosphate. Together with protein kinases, these enzymes control the state of phosphorylation of cell proteins and thereby provide an important mechanism for regulating cellular activity.
• GO:0004725 Protein tyrosine phosphatase activity
  Catalysis of the reaction: protein tyrosine phosphate + H2O = protein tyrosine + phosphate.
• GO:0004725 Protein tyrosine phosphatase activity
  Catalysis of the reaction: protein tyrosine phosphate + H2O = protein tyrosine + phosphate.
• GO:0004726 Non-membrane spanning protein tyrosine phosphatase activity
  Catalysis of the reaction: non-membrane spanning protein tyrosine phosphate + H2O = non-membrane spanning protein tyrosine + phosphate.
• GO:0004726 Non-membrane spanning protein tyrosine phosphatase activity
  Catalysis of the reaction: non-membrane spanning protein tyrosine phosphate + H2O = non-membrane spanning protein tyrosine + phosphate.
• GO:0005070 SH3/SH2 adaptor activity
  Interacting selectively and non-covalently and simultaneously with one or more signal transduction molecules, usually acting as a scaffold to bring these molecules into close proximity either using their own SH2/SH3 domains (e.g. Grb2) or those of their target molecules (e.g. SAM68).
• GO:0005158 Insulin receptor binding
  Interacting selectively and non-covalently with the insulin receptor.
• GO:0005515 Protein binding
  Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
• GO:0030971 Receptor tyrosine kinase binding
  Interacting selectively and non-covalently with a receptor that possesses protein tyrosine kinase activity.
• GO:0050839 Cell adhesion molecule binding
  Interacting selectively and non-covalently with a cell adhesion molecule.
• GO:0051428 Peptide hormone receptor binding
  Interacting selectively and non-covalently with a receptor for peptide hormones.

Biological process (56)

• GO:0000077 DNA damage checkpoint
  A cell cycle checkpoint that regulates progression through the cell cycle in response to DNA damage. A DNA damage checkpoint may blocks cell cycle progression (in G1, G2 or metaphase) or slow the rate at which S phase proceeds.
• GO:0000187 Activation of MAPK activity
  The initiation of the activity of the inactive enzyme MAP kinase (MAPK).
• GO:0006629 Lipid metabolic process
  The chemical reactions and pathways involving lipids, compounds soluble in an organic solvent but not, or sparingly, in an aqueous solvent. Includes fatty acids; neutral fats, other fatty-acid esters, and soaps; long-chain (fatty) alcohols and waxes; sphingoids and other long-chain bases; glycolipids, phospholipids and sphingolipids; and carotenes, polyprenols, sterols, terpenes and other isoprenoids.
• GO:0006641 Triglyceride metabolic process
  The chemical reactions and pathways involving triglyceride, any triester of glycerol. The three fatty acid residues may all be the same or differ in any permutation. Triglycerides are important components of plant oils, animal fats and animal plasma lipoproteins.
• GO:0007173 Epidermal growth factor receptor signaling pathway
  A series of molecular signals initiated by binding of a ligand to the tyrosine kinase receptor EGFR (ERBB1) on the surface of a cell. The pathway ends with regulation of a downstream cellular process, e.g. transcription.
• GO:0007229 Integrin-mediated signaling pathway
  A series of molecular signals initiated by the binding of extracellular ligand to an integrin on the surface of a target cell, and ending with regulation of a downstream cellular process, e.g. transcription.
• GO:0007409 Axonogenesis
  De novo generation of a long process of a neuron, that carries efferent (outgoing) action potentials from the cell body towards target cells. Refers to the morphogenesis or creation of shape or form of the developing axon.
• GO:0007420 Brain development
  The process whose specific outcome is the progression of the brain over time, from its formation to the mature structure. Brain development begins with patterning events in the neural tube and ends with the mature structure that is the center of thought and emotion. The brain is responsible for the coordination and control of bodily activities and the interpretation of information from the senses (sight, hearing, smell, etc.).
• GO:0007507 Heart development
  The process whose specific outcome is the progression of the heart over time, from its formation to the mature structure. The heart is a hollow, muscular organ, which, by contracting rhythmically, keeps up the circulation of the blood.
• GO:0009755 Hormone-mediated signaling pathway
  A series of molecular signals mediated by the detection of a hormone.
• GO:0009967 Positive regulation of signal transduction
  Any process that activates or increases the frequency, rate or extent of signal transduction.
• GO:0021697 Cerebellar cortex formation
  The process that gives rise to the cerebellar cortex. This process pertains to the initial formation of a structure from unspecified parts. The cerebellar cortex is a thin mantle of gray matter that covers the surface of each cerebral hemisphere. It has a characteristic morphology with convolutions (gyri) and crevices (sulci) that have specific functions. Six layers of nerve cells and the nerve pathways that connect them comprise the cerebellar cortex. Together, these regions are responsible for the processes of conscious thought, perception, emotion and memory as well as advanced motor function.
• GO:0021697 Cerebellar cortex formation
  The process that gives rise to the cerebellar cortex. This process pertains to the initial formation of a structure from unspecified parts. The cerebellar cortex is a thin mantle of gray matter that covers the surface of each cerebral hemisphere. It has a characteristic morphology with convolutions (gyri) and crevices (sulci) that have specific functions. Six layers of nerve cells and the nerve pathways that connect them comprise the cerebellar cortex. Together, these regions are responsible for the processes of conscious thought, perception, emotion and memory as well as advanced motor function.
• GO:0030220 Platelet formation
  The process in which platelets bud from long processes extended by megakaryocytes.
• GO:0032528 Microvillus organization
  A process that is carried out at the cellular level which results in the assembly, arrangement of constituent parts, or disassembly of a microvillus, a thin cylindrical membrane-covered projection on the surface of a cell.
• GO:0033277 Abortive mitotic cell cycle
  A cell cycle in which mitosis is begun and progresses normally through the end of anaphase, but not completed, resulting in a cell with increased ploidy.
• GO:0033628 Regulation of cell adhesion mediated by integrin
  Any process that modulates the frequency, rate, or extent of cell adhesion mediated by integrin.
• GO:0033628 Regulation of cell adhesion mediated by integrin
  Any process that modulates the frequency, rate, or extent of cell adhesion mediated by integrin.
• GO:0033629 Negative regulation of cell adhesion mediated by integrin
  Any process that stops, prevents, or reduces the frequency, rate, or extent of cell adhesion mediated by integrin.
• GO:0035264 Multicellular organism growth
  The increase in size or mass of an entire multicellular organism, as opposed to cell growth.
• GO:0035265 Organ growth
  The increase in size or mass of an organ. Organs are commonly observed as visibly distinct structures, but may also exist as loosely associated clusters of cells that function together as to perform a specific function.
• GO:0035335 Peptidyl-tyrosine dephosphorylation
  The removal of phosphoric residues from peptidyl-O-phospho-tyrosine to form peptidyl-tyrosine.
• GO:0035335 Peptidyl-tyrosine dephosphorylation
  The removal of phosphoric residues from peptidyl-O-phospho-tyrosine to form peptidyl-tyrosine.
• GO:0035855 Megakaryocyte development
  The process whose specific outcome is the progression of a megakaryocyte cell over time, from its formation to the mature structure. Megakaryocyte development does not include the steps involved in committing a cell to a megakaryocyte fate. A megakaryocyte is a giant cell 50 to 100 micron in diameter, with a greatly lobulated nucleus, found in the bone marrow.
• GO:0036302 Atrioventricular canal development
  The progression of the atrioventricular canal over time, from its formation to the mature structure. The atrioventricular canal is the part of the heart connecting the atrium to the cardiac ventricle.
• GO:0038127 ERBB signaling pathway
  A series of molecular signals initiated by binding of a ligand to a member of the ERBB family of receptor tyrosine kinases on the surface of a cell, and ending with regulation of a downstream cellular process, e.g. transcription.
• GO:0040014 Regulation of multicellular organism growth
  Any process that modulates the frequency, rate or extent of growth of the body of an organism so that it reaches its usual body size.
• GO:0042445 Hormone metabolic process
  The chemical reactions and pathways involving any hormone, naturally occurring substances secreted by specialized cells that affects the metabolism or behavior of other cells possessing functional receptors for the hormone.
• GO:0042593 Glucose homeostasis
  Any process involved in the maintenance of an internal steady state of glucose within an organism or cell.
• GO:0043254 Regulation of protein complex assembly
  Any process that modulates the frequency, rate or extent of protein complex assembly.
• GO:0045931 Positive regulation of mitotic cell cycle
  Any process that activates or increases the rate or extent of progression through the mitotic cell cycle.
• GO:0046676 Negative regulation of insulin secretion
  Any process that stops, prevents, or reduces the frequency, rate or extent of the regulated release of insulin.
• GO:0046825 Regulation of protein export from nucleus
  Any process that modulates the frequency, rate or extent of the directed movement of proteins from the nucleus to the cytoplasm.
• GO:0046887 Positive regulation of hormone secretion
  Any process that activates or increases the frequency, rate or extent of the regulated release of a hormone from a cell.
• GO:0046888 Negative regulation of hormone secretion
  Any process that stops, prevents, or reduces the frequency, rate or extent of the regulated release of a hormone from a cell.
• GO:0048008 Platelet-derived growth factor receptor signaling pathway
  The series of molecular signals generated as a consequence of a platelet-derived growth factor receptor binding to one of its physiological ligands.
• GO:0048011 Neurotrophin TRK receptor signaling pathway
  A series of molecular signals initiated by the binding of a neurotrophin to a receptor on the surface of the target cell where the receptor possesses tyrosine kinase activity, and ending with regulation of a downstream cellular process, e.g. transcription.
• GO:0048013 Ephrin receptor signaling pathway
  The series of molecular signals generated as a consequence of an ephrin receptor binding to an ephrin.
• GO:0048013 Ephrin receptor signaling pathway
  The series of molecular signals generated as a consequence of an ephrin receptor binding to an ephrin.
• GO:0048609 Multicellular organismal reproductive process
  The process, occurring above the cellular level, that is pertinent to the reproductive function of a multicellular organism. This includes the integrated processes at the level of tissues and organs.
• GO:0048806 Genitalia development
  The process whose specific outcome is the progression of the genitalia over time, from its formation to the mature structure.
• GO:0048839 Inner ear development
  The process whose specific outcome is the progression of the inner ear over time, from its formation to the mature structure.
• GO:0048873 Homeostasis of number of cells within a tissue
  Any biological process involved in the maintenance of the steady-state number of cells within a population of cells in a tissue.
• GO:0048873 Homeostasis of number of cells within a tissue
  Any biological process involved in the maintenance of the steady-state number of cells within a population of cells in a tissue.
• GO:0051463 Negative regulation of cortisol secretion
  Any process that stops, prevents, or reduces the frequency, rate or extent of the regulated release of cortisol from a cell.
• GO:0060020 Bergmann glial cell differentiation
  The process in which neuroepithelial cells of the neural tube give rise to Brgmann glial cells, specialized bipotential progenitors cells of the cerebellum. Differentiation includes the processes involved in commitment of a cell to a specific fate.
• GO:0060020 Bergmann glial cell differentiation
  The process in which neuroepithelial cells of the neural tube give rise to Brgmann glial cells, specialized bipotential progenitors cells of the cerebellum. Differentiation includes the processes involved in commitment of a cell to a specific fate.
• GO:0060125 Negative regulation of growth hormone secretion
  Any process that decreases or stops the frequency, rate or extent of the regulated release of growth hormone from a cell.
• GO:0060325 Face morphogenesis
  The process in which the anatomical structures of the face are generated and organized. The face is the ventral division of the head.
• GO:0061582 Intestinal epithelial cell migration
  The orderly movement of an intestinal epithelial cell from one site to another, often during the development of a multicellular organism.
• GO:0070374 Positive regulation of ERK1 and ERK2 cascade
  Any process that activates or increases the frequency, rate or extent of signal transduction mediated by the ERK1 and ERK2 cascade.
• GO:0070374 Positive regulation of ERK1 and ERK2 cascade
  Any process that activates or increases the frequency, rate or extent of signal transduction mediated by the ERK1 and ERK2 cascade.
• GO:0070374 Positive regulation of ERK1 and ERK2 cascade
  Any process that activates or increases the frequency, rate or extent of signal transduction mediated by the ERK1 and ERK2 cascade.
• GO:0071364 Cellular response to epidermal growth factor stimulus
  Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an epidermal growth factor stimulus.
• GO:0071364 Cellular response to epidermal growth factor stimulus
  Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an epidermal growth factor stimulus.
• GO:2001275 Positive regulation of glucose import in response to insulin stimulus
  Any process that activates or increases the frequency, rate or extent of glucose import in response to insulin stimulus.

Protein Sequence

>P35235
MTSRRWFHPNITGVEAENLLLTRGVDGSFLARPSKSNPGDFTLSVRRNGAVTHIKIQNTGDYYDLYGGEKFATLAELVQY
YMEHHGQLKEKNGDVIELKYPLNCADPTSERWFHGHLSGKEAEKLLTEKGKHGSFLVRESQSHPGDFVLSVRTGDDKGES
NDGKSKVTHVMIRCQELKYDVGGGERFDSLTDLVEHYKKNPMVETLGTVLQLKQPLNTTRINAAEIESRVRELSKLAETT
DKVKQGFWEEFETLQQQECKLLYSRKEGQRQENKNKNRYKNILPFDHTRVVLHDGDPNEPVSDYINANIIMPEFETKCNN
SKPKKSYIATQGCLQNTVNDFWRMVFQENSRVIVMTTKEVERGKSKCVKYWPDEYALKEYGVMRVRNVKESAAHDYTLRE
LKLSKVGQALLQGNTERTVWQYHFRTWPDHGVPSDPGGVLDFLEEVHHKQESIVDAGPVVVHCSAGIGRTGTFIVIDILI
DIIREKGVDCDIDVPKTIQMVRSQRSGMVQTEAQYRFIYMAVQHYIETLQRRIEEEQKSKRKGHEYTNIKYSLVDQTSGD
QSPLPPCTPTPPCAEMREDSARVYENVGLMQQQRSFR