Btk Tyrosine-protein kinase BTK
UniProt Data
Accession | P35991 [ UniProt ] |
Name | BTK_MOUSE |
Description | Tyrosine-protein kinase BTK |
Species | Mus musculus |
Sequence Length | 659 |
Enzyme Annotations (1)
- EC:2.7.10.2 Non-specific protein-tyrosine kinase.
ATP + a [protein]-L-tyrosine = ADP + a [protein]-L-tyrosine phosphate.
GO Annotations
Cellular component (7)
- GO:0005634 Nucleus
A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent. - GO:0005737 Cytoplasm
All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures. - GO:0005829 Cytosol
The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes. - GO:0005829 Cytosol
The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes. - GO:0005886 Plasma membrane
The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins. - GO:0031410 Cytoplasmic vesicle
A vesicle found in the cytoplasm of a cell. - GO:0045121 Membrane raft
Any of the small (10-200 nm), heterogeneous, highly dynamic, sterol- and sphingolipid-enriched membrane domains that compartmentalize cellular processes. Small rafts can sometimes be stabilized to form larger platforms through protein-protein and protein-lipid interactions.
Molecular function (5)
- GO:0004713 Protein tyrosine kinase activity
Catalysis of the reaction: ATP + a protein tyrosine = ADP + protein tyrosine phosphate. - GO:0004713 Protein tyrosine kinase activity
Catalysis of the reaction: ATP + a protein tyrosine = ADP + protein tyrosine phosphate. - GO:0005515 Protein binding
Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules). - GO:0005547 Phosphatidylinositol-3,4,5-trisphosphate binding
Interacting selectively and non-covalently with phosphatidylinositol-3,4,5-trisphosphate, a derivative of phosphatidylinositol in which the inositol ring is phosphorylated at the 3', 4' and 5' positions. - GO:0042802 Identical protein binding
Interacting selectively and non-covalently with an identical protein or proteins.
Biological process (10)
- GO:0001818 Negative regulation of cytokine production
Any process that stops, prevents, or reduces the rate of production of a cytokine. - GO:0002344 B cell affinity maturation
The process in which B cells produce antibodies with increased antigen affinity. This is accomplished by somatic hypermutation and selection for B cells which produce higher affinity antibodies to antigen. - GO:0006468 Protein phosphorylation
The process of introducing a phosphate group on to a protein. - GO:0007249 I-kappaB kinase/NF-kappaB signaling
The process in which a signal is passed on to downstream components within the cell through the I-kappaB-kinase (IKK)-dependent activation of NF-kappaB. The cascade begins with activation of a trimeric IKK complex (consisting of catalytic kinase subunits IKKalpha and/or IKKbeta, and the regulatory scaffold protein NEMO) and ends with the regulation of transcription of target genes by NF-kappaB. In a resting state, NF-kappaB dimers are bound to I-kappaB proteins, sequestering NF-kappaB in the cytoplasm. Phosphorylation of I-kappaB targets I-kappaB for ubiquitination and proteasomal degradation, thus releasing the NF-kappaB dimers, which can translocate to the nucleus to bind DNA and regulate transcription. - GO:0018108 Peptidyl-tyrosine phosphorylation
The phosphorylation of peptidyl-tyrosine to form peptidyl-O4'-phospho-L-tyrosine. - GO:0018108 Peptidyl-tyrosine phosphorylation
The phosphorylation of peptidyl-tyrosine to form peptidyl-O4'-phospho-L-tyrosine. - GO:0030889 Negative regulation of B cell proliferation
Any process that stops, prevents or reduces the rate or extent of B cell proliferation. - GO:0038095 Fc-epsilon receptor signaling pathway
A series of molecular signals initiated by the binding of the Fc portion of immunoglobulin E (IgE) to an Fc-epsilon receptor on the surface of a signal-receiving cell, and ending with regulation of a downstream cellular process, e.g. transcription. The Fc portion of an immunoglobulin is its C-terminal constant region. - GO:0048469 Cell maturation
A developmental process, independent of morphogenetic (shape) change, that is required for a cell to attain its fully functional state. - GO:0098761 Cellular response to interleukin-7
Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an interleukin-7 stimulus.
Protein Sequence
>P35991 MAAVILESIFLKRSQQKKKTSPLNFKKRLFLLTVHKLSYYEYDFERGRRGSKKGSIDVEKITCVETVIPEKNPPPERQIP RRGEESSEMEQISIIERFPYPFQVVYDEGPLYVFSPTEELRKRWIHQLKNVIRYNSDLVQKYHPCFWIDGQYLCCSQTAK NAMGCQILENRNGSLKPGSSHRKTKKPLPPTPEEDQILKKPLPPEPTAAPISTTELKKVVALYDYMPMNANDLQLRKGEE YFILEESNLPWWRARDKNGQEGYIPSNYITEAEDSIEMYEWYSKHMTRSQAEQLLKQEGKEGGFIVRDSSKAGKYTVSVF AKSTGEPQGVIRHYVVCSTPQSQYYLAEKHLFSTIPELINYHQHNSAGLISRLKYPVSKQNKNAPSTAGLGYGSWEIDPK DLTFLKELGTGQFGVVKYGKWRGQYDVAIKMIREGSMSEDEFIEEAKVMMNLSHEKLVQLYGVCTKQRPIFIITEYMANG CLLNYLREMRHRFQTQQLLEMCKDVCEAMEYLESKQFLHRDLAARNCLVNDQGVVKVSDFGLSRYVLDDEYTSSVGSKFP VRWSPPEVLMYSKFSSKSDIWAFGVLMWEIYSLGKMPYERFTNSETAEHIAQGLRLYRPHLASERVYTIMYSCWHEKADE RPSFKILLSNILDVMDEES