MYO3 Myosin-3

• Overview
• Annotations

UniProt Data

Enzyme Annotations (0)

GO Annotations

Cellular component (1)

Molecular function (3)

• GO:0000146 Microfilament motor activity
  Catalysis of movement along a microfilament, coupled to the hydrolysis of a nucleoside triphosphate (usually ATP).
• GO:0005515 Protein binding
  Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
• GO:0017022 Myosin binding
  Interacting selectively and non-covalently with any part of a myosin complex; myosins are any of a superfamily of molecular motor proteins that bind to actin and use the energy of ATP hydrolysis to generate force and movement along actin filaments.

Biological process (7)

• GO:0006887 Exocytosis
  A process of secretion by a cell that results in the release of intracellular molecules (e.g. hormones, matrix proteins) contained within a membrane-bounded vesicle by fusion of the vesicle with the plasma membrane of a cell. This process begins with steps that prepare vesicles for fusion with the membrane (tethering and docking) and ends when vesicle fusion is complete. This is the process in which most molecules are secreted from eukaryotic cells.
• GO:0006897 Endocytosis
  A vesicle-mediated transport process in which cells take up external materials or membrane constituents by the invagination of a small region of the plasma membrane to form a new membrane-bounded vesicle.
• GO:0006970 Response to osmotic stress
  Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus indicating an increase or decrease in the concentration of solutes outside the organism or cell.
• GO:0007121 Bipolar cellular bud site selection
  The process of defining subsequent sites of bud emergence such that budding takes place at alternating poles of a budding cell.
• GO:0031505 Fungal-type cell wall organization
  A process that is carried out at the cellular level which results in the assembly, arrangement of constituent parts, or disassembly of the fungal-type cell wall.
• GO:0051666 Actin cortical patch localization
  Any process in which actin cortical patches are transported to, or maintained in, a specific location. An actin cortical patch is a discrete actin-containing structure found just beneath the plasma membrane in fungal cells.
• GO:2000601 Positive regulation of Arp2/3 complex-mediated actin nucleation
  Any process that activates or increases the frequency, rate or extent of Arp2/3 complex-mediated actin nucleation.

Protein Sequence

>P36006
MAVIKKGARRKDVKEPKKRSAKIKKATFDANKKKEVGISDLTLLSKISDESINENLKKRFKNGIIYTYIGHVLISVNPFR
DLGIYTNAVLESYKGKNRLEVPPHVFAIAESMYYNLKSYNENQCVIISGESGAGKTEAAKRIMQYIAAASNSHSESIGKI
KDMVLATNPLLESFGCAKTLRNNNSSRHGKYLEIKFNSQFEPCAGNITNYLLEKQRVVGQIKNERNFHIFYQFTKGASDT
YKQMFGVQMPEQYIYTAAAGCTTADTIDDVKDYEGTLEAMRTIGLVQEEQDQIFRMLAAILWIGNISFIENEEGNAQVGD
TSVTDFVAYLLQVDASLLVKCLVERIMQTSHGMKRGSVYHVPLNPVQATAVRDALAKAIYNNLFDWIVDRVNVSLQAFPG
ADKSIGILDIYGFEIFEHNSFEQICINYVNEKLQQIFIQLTLKAEQETYEREKIKWTPIKYFDNKVVCDLIEAKNPPGIL
AAMNDSIATAHADSNAADQAFAQRLNLFNSNPYFELRANKFVIKHYAGDVTYDINGITDKNKDQLQKDLIELIGTTTNTF
LSTIFPDDVDKDSKRRPPTAGDKIIKSANELVETLSKAEPSYIRTIKPNQTKSPNDYDDHQVLHQVKYLGLQENVRIRRA
GFAYRQTFEKFVERFYLLSPDCSYAGDYTWDGDTLEAVKLILRDAMIPEKEFQLGVTSVFIKTPESLFALEDMRDKYWYN
MAARIQRAWRRFLQRRIDAAIKIQRTIREKKGGNKYVKLRDYGTKLLAGKKERRSMSLLGYRAFMGDYLSCNESKTKGSY
IRRQVGIKDKVVFSIKGECLHSKFGRSAQRLKKVFILTKKTFYIIGQTREQNAMKYTQDYKIDVGKIKQVSLTNLQDDWM
GVILVNSTQSDPLINTPFKTELMTRLKKLNEKIMIKVGPTIEYHKQPNKLHTVRSKISDSAPKYGDIYKSSTIYVRRGHP
ANSKSNKKPKNPGGLSGKPIKSKKSKHKSTHKHTHSHRSHRDAAKKQPLPSQKPVNPLSLAATAAQAAYNPKPDKTVPIK
SSAIPAAKVSSKHSSKPSSKEKVAVKKASSSHKSSSAKQNQVSMPPSKGVEKNKEPLKETTATATANIPIPPPPPPMGQP
KDPKFEAAYDFPGSGSSSELPLKKGDIVFISRDEPSGWSLAKLLDGSKEGWVPTAYMTPYKDTRNTVPVAATGAVNDVTN
QKSSQIDNTISSAQEGVQFGSATVGPTSDNQSNPVGTFSDGLASALAARANKMRAESADDDDNDDGDDDDDW