BZZ1 Protein BZZ1
UniProt Data
Accession | P38822 [ UniProt ] |
Name | BZZ1_YEAST |
Description | Protein BZZ1 |
Species | Saccharomyces cerevisiae S288C |
Sequence Length | 633 |
Enzyme Annotations (0)
GO Annotations
Cellular component (2)
- GO:0005886 Plasma membrane
The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins. - GO:0030479 Actin cortical patch
An endocytic patch that consists of an actin-containing structure found at the plasma membrane in cells; formed of networks of branched actin filaments that lie just beneath the plasma membrane and assemble, move, and disassemble rapidly. An example of this is the actin cortical patch found in Saccharomyces cerevisiae.
Molecular function (2)
- GO:0005515 Protein binding
Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules). - GO:0008047 Enzyme activator activity
Binds to and increases the activity of an enzyme.
Biological process (5)
- GO:0006897 Endocytosis
A vesicle-mediated transport process in which cells take up external materials or membrane constituents by the invagination of a small region of the plasma membrane to form a new membrane-bounded vesicle. - GO:0007015 Actin filament organization
A process that is carried out at the cellular level which results in the assembly, arrangement of constituent parts, or disassembly of cytoskeletal structures comprising actin filaments. Includes processes that control the spatial distribution of actin filaments, such as organizing filaments into meshworks, bundles, or other structures, as by cross-linking. - GO:0009651 Response to salt stress
Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus indicating an increase or decrease in the concentration of salt (particularly but not exclusively sodium and chloride ions) in the environment. - GO:0009651 Response to salt stress
Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus indicating an increase or decrease in the concentration of salt (particularly but not exclusively sodium and chloride ions) in the environment. - GO:0045010 Actin nucleation
The initial step in the formation of an actin filament, in which actin monomers combine to form a new filament. Nucleation is slow relative to the subsequent addition of more monomers to extend the filament.
Protein Sequence
>P38822 MSADLSIGNEIKDSFKETHKWVQNNLKWLKDIEQFYRERAKLEKDYSERLSRLSAEYFNKKSSTSVPISVGDTPTTTPGS IEAAGVVAWNEILSQTDMISKDHDQLSTDFENHVANQLSGLFTKLDMTLSKINGFNNDMVNKKDNIYHELEKAKKDYDEA CSTMEMARNRYTKASNDRNKKKLDEKEMEMNKCKNEYLIKINQANRTKDKYYFQDVPEVLDLLQDVNEAKTLFLNDLWLK AASVENDLGANVSKRLQAANSVVKQNKPSLNTAIFIKHNLKNWKEPQDFVYKPSPVWHDDEKFAVPSSLEVEDLRIKLAK AENDYNSLQDKTQNELSKLSTLNKIKHEMKTNEDNINATKFYDTLKEYLNVVSPFTSHETLKLQAEVQIESIQNNVPEEY DLSTDNIDLSKTKKKSGIFSKFKHNILNVDSKPSSGGSTGNGNGGPLHITSLFNTSRRTRLGSAPNNAGEDSDNNSIRTT STNNTKKTTQNSSDDGKNKVLYAYVQKDDDEITITPGDKISLVARDTGSGWTKINNDTTGETGLVPTTYIRISSAATVKA NDRGPAPEVPPPRRSTLPVRTMEAIYAYEAQGDDEISIDPGDIITVIRGDDGSGWTYGECDGLKGLFPTSYCK