Txk Tyrosine-protein kinase TXK
UniProt Data
Accession | P42682 [ UniProt ] |
Name | TXK_MOUSE |
Description | Tyrosine-protein kinase TXK |
Species | Mus musculus |
Sequence Length | 527 |
Enzyme Annotations (1)
- EC:2.7.10.2 Non-specific protein-tyrosine kinase.
ATP + a [protein]-L-tyrosine = ADP + a [protein]-L-tyrosine phosphate.
GO Annotations
Cellular component (2)
- GO:0005634 Nucleus
A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent. - GO:0005737 Cytoplasm
All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
Molecular function (3)
- GO:0000978 RNA polymerase II core promoter proximal region sequence-specific DNA binding
Interacting selectively and non-covalently with a sequence of DNA that is in cis with and relatively close to a core promoter for RNA polymerase II. - GO:0001012 RNA polymerase II regulatory region DNA binding
Interacting selectively and non-covalently with a DNA region that controls the transcription of a region of DNA by RNA polymerase II. Binding may occur as a sequence specific interaction or as an interaction observed only once a factor has been recruited to the DNA by other factors. - GO:0001077 Transcriptional activator activity, RNA polymerase II core promoter proximal region sequence-specific binding
Interacting selectively and non-covalently with a sequence of DNA that is in cis with and relatively close to a core promoter for RNA polymerase II (RNAP II) in order to activate or increase the frequency, rate or extent of transcription from the RNAP II promoter.
Biological process (13)
- GO:0001816 Cytokine production
The appearance of a cytokine due to biosynthesis or secretion following a cellular stimulus, resulting in an increase in its intracellular or extracellular levels. - GO:0001865 NK T cell differentiation
The process in which a precursor cell type acquires the specialized features of a NK T cell. - GO:0002250 Adaptive immune response
An immune response mediated by cells expressing specific receptors for antigen produced through a somatic diversification process, and allowing for an enhanced secondary response to subsequent exposures to the same antigen (immunological memory). - GO:0006357 Regulation of transcription from RNA polymerase II promoter
Any process that modulates the frequency, rate or extent of transcription from an RNA polymerase II promoter. - GO:0006468 Protein phosphorylation
The process of introducing a phosphate group on to a protein. - GO:0007202 Activation of phospholipase C activity
The initiation of the activity of the inactive enzyme phospolipase C as the result of a series of molecular signals generated as a consequence of a G-protein coupled receptor binding to its physiological ligand. - GO:0032609 Interferon-gamma production
The appearance of interferon-gamma due to biosynthesis or secretion following a cellular stimulus, resulting in an increase in its intracellular or extracellular levels. Interferon-gamma is also known as type II interferon. - GO:0032633 Interleukin-4 production
The appearance of interleukin-4 due to biosynthesis or secretion following a cellular stimulus, resulting in an increase in its intracellular or extracellular levels. - GO:0032729 Positive regulation of interferon-gamma production
Any process that activates or increases the frequency, rate, or extent of interferon-gamma production. Interferon-gamma is also known as type II interferon. - GO:0045944 Positive regulation of transcription from RNA polymerase II promoter
Any process that activates or increases the frequency, rate or extent of transcription from an RNA polymerase II promoter. - GO:0046777 Protein autophosphorylation
The phosphorylation by a protein of one or more of its own amino acid residues (cis-autophosphorylation), or residues on an identical protein (trans-autophosphorylation). - GO:0050852 T cell receptor signaling pathway
A series of molecular signals initiated by the cross-linking of an antigen receptor on a T cell. - GO:0060335 Positive regulation of interferon-gamma-mediated signaling pathway
Any process that increases the rate, frequency or extent of the series of molecular events generated as a consequence of interferon-gamma binding to a cell surface receptor.
Protein Sequence
>P42682 MILSSYSSFQSVLCCCCCRCSVQKRQVRTQISLSREEELSEKHSQRQRPWFAKLMGKTQSNRGGVQPSKRKPLPPLPQEP PDERIQVKALYDFLPREPGNLALKRAEEYLILERCDPHWWKARDRFGNEGLIPSNYVTENRLANLEIYEWYHKNITRNQT ERLLRQEAKEGAFIVRDSRHLGSYTISVFTRARRHTQSSIKHYQIKKNDSGQWYITERHLFPSVPELIQYHQYNAAGLIS RLRYPIGLLGSCLPATSGFSYEKWEIDPSELAFVKEIGSGQFGVVHLGEWRAHIPVAIKAINEGSMSEEDFIEEAKVMMK LSHSRLVQLYGVCIQQKPLYIVTEFMENGCLLDYLRERKGQLQKALLLSMCQDICEGMAYLERSCYIHRDLAARNCLVSS ACVVKISDFGMARYVLDDEYISSSGAKFPVKWCPPEVFHFNKYSSKSDVWSFGVLMWEVFTEGKMPFENKSNLQVVEAIS QGFRLYRPHLAPMTIYRVMYSCWHESPKGRPTFAELLQVLTEIAETW