ZAP70 Tyrosine-protein kinase ZAP-70

• Overview
• Annotations

UniProt Data

Enzyme Annotations (1)

• EC:2.7.10.2 Non-specific protein-tyrosine kinase.
  ATP + a [protein]-L-tyrosine = ADP + a [protein]-L-tyrosine phosphate.

GO Annotations

Cellular component (5)

• GO:0005737 Cytoplasm
  All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
• GO:0005829 Cytosol
  The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
• GO:0005886 Plasma membrane
  The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
• GO:0005886 Plasma membrane
  The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
• GO:0042101 T cell receptor complex
  A protein complex that contains a disulfide-linked heterodimer of T cell receptor (TCR) chains, which are members of the immunoglobulin superfamily, and mediates antigen recognition, ultimately resulting in T cell activation. The TCR heterodimer is associated with the CD3 complex, which consists of the nonpolymorphic polypeptides gamma, delta, epsilon, zeta, and, in some cases, eta (an RNA splice variant of zeta) or Fc epsilon chains.

Molecular function (6)

• GO:0004713 Protein tyrosine kinase activity
  Catalysis of the reaction: ATP + a protein tyrosine = ADP + protein tyrosine phosphate.
• GO:0004713 Protein tyrosine kinase activity
  Catalysis of the reaction: ATP + a protein tyrosine = ADP + protein tyrosine phosphate.
• GO:0004713 Protein tyrosine kinase activity
  Catalysis of the reaction: ATP + a protein tyrosine = ADP + protein tyrosine phosphate.
• GO:0004715 Non-membrane spanning protein tyrosine kinase activity
  Catalysis of the reaction: ATP + protein L-tyrosine = ADP + protein L-tyrosine phosphate by a non-membrane spanning protein.
• GO:0005515 Protein binding
  Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
• GO:0005524 ATP binding
  Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.

Biological process (15)

• GO:0002250 Adaptive immune response
  An immune response mediated by cells expressing specific receptors for antigen produced through a somatic diversification process, and allowing for an enhanced secondary response to subsequent exposures to the same antigen (immunological memory).
• GO:0006468 Protein phosphorylation
  The process of introducing a phosphate group on to a protein.
• GO:0006468 Protein phosphorylation
  The process of introducing a phosphate group on to a protein.
• GO:0006955 Immune response
  Any immune system process that functions in the calibrated response of an organism to a potential internal or invasive threat.
• GO:0018108 Peptidyl-tyrosine phosphorylation
  The phosphorylation of peptidyl-tyrosine to form peptidyl-O4'-phospho-L-tyrosine.
• GO:0018108 Peptidyl-tyrosine phosphorylation
  The phosphorylation of peptidyl-tyrosine to form peptidyl-O4'-phospho-L-tyrosine.
• GO:0030217 T cell differentiation
  The process in which a precursor cell type acquires characteristics of a more mature T-cell. A T cell is a type of lymphocyte whose definin characteristic is the expression of a T cell receptor complex.
• GO:0035556 Intracellular signal transduction
  The process in which a signal is passed on to downstream components within the cell, which become activated themselves to further propagate the signal and finally trigger a change in the function or state of the cell.
• GO:0042110 T cell activation
  The change in morphology and behavior of a mature or immature T cell resulting from exposure to a mitogen, cytokine, chemokine, cellular ligand, or an antigen for which it is specific.
• GO:0042113 B cell activation
  The change in morphology and behavior of a mature or immature B cell resulting from exposure to a mitogen, cytokine, chemokine, cellular ligand, or an antigen for which it is specific.
• GO:0045059 Positive thymic T cell selection
  The process of sparing immature T cells in the thymus which react with self-MHC protein complexes with low affinity levels from apoptotic death.
• GO:0045582 Positive regulation of T cell differentiation
  Any process that activates or increases the frequency, rate or extent of T cell differentiation.
• GO:0050852 T cell receptor signaling pathway
  A series of molecular signals initiated by the cross-linking of an antigen receptor on a T cell.
• GO:0070489 T cell aggregation
  The adhesion of one T cell to one or more other T cells via adhesion molecules.
• GO:0072678 T cell migration
  The movement of a T cell within or between different tissues and organs of the body.

Protein Sequence

>P43403
MPDPAAHLPFFYGSISRAEAEEHLKLAGMADGLFLLRQCLRSLGGYVLSLVHDVRFHHFPIERQLNGTYAIAGGKAHCGP
AELCEFYSRDPDGLPCNLRKPCNRPSGLEPQPGVFDCLRDAMVRDYVRQTWKLEGEALEQAIISQAPQVEKLIATTAHER
MPWYHSSLTREEAERKLYSGAQTDGKFLLRPRKEQGTYALSLIYGKTVYHYLISQDKAGKYCIPEGTKFDTLWQLVEYLK
LKADGLIYCLKEACPNSSASNASGAAAPTLPAHPSTLTHPQRRIDTLNSDGYTPEPARITSPDKPRPMPMDTSVYESPYS
DPEELKDKKLFLKRDNLLIADIELGCGNFGSVRQGVYRMRKKQIDVAIKVLKQGTEKADTEEMMREAQIMHQLDNPYIVR
LIGVCQAEALMLVMEMAGGGPLHKFLVGKREEIPVSNVAELLHQVSMGMKYLEEKNFVHRDLAARNVLLVNRHYAKISDF
GLSKALGADDSYYTARSAGKWPLKWYAPECINFRKFSSRSDVWSYGVTMWEALSYGQKPYKKMKGPEVMAFIEQGKRMEC
PPECPPELYALMSDCWIYKWEDRPDFLTVEQRMRACYYSLASKVEGPPGSTQKAEAACA