Crkl Crk-like protein
UniProt Data
Accession | P47941 [ UniProt ] |
Name | CRKL_MOUSE |
Description | Crk-like protein |
Species | Mus musculus |
Sequence Length | 303 |
Enzyme Annotations (0)
GO Annotations
Cellular component (1)
None predictedMolecular function (4)
- GO:0001784 Phosphotyrosine binding
Interacting selectively and non-covalently with a phosphorylated tyrosine residue within a protein. - GO:0003723 RNA binding
Interacting selectively and non-covalently with an RNA molecule or a portion thereof. - GO:0005515 Protein binding
Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules). - GO:0045296 Cadherin binding
Interacting selectively and non-covalently with cadherin, a type I membrane protein involved in cell adhesion.
Biological process (9)
- GO:0001568 Blood vessel development
The process whose specific outcome is the progression of a blood vessel over time, from its formation to the mature structure. The blood vessel is the vasculature carrying blood. - GO:0007389 Pattern specification process
Any developmental process that results in the creation of defined areas or spaces within an organism to which cells respond and eventually are instructed to differentiate. - GO:0007507 Heart development
The process whose specific outcome is the progression of the heart over time, from its formation to the mature structure. The heart is a hollow, muscular organ, which, by contracting rhythmically, keeps up the circulation of the blood. - GO:0008284 Positive regulation of cell proliferation
Any process that activates or increases the rate or extent of cell proliferation. - GO:0009887 Animal organ morphogenesis
Morphogenesis of an animal organ. An organ is defined as a tissue or set of tissues that work together to perform a specific function or functions. Morphogenesis is the process in which anatomical structures are generated and organized. Organs are commonly observed as visibly distinct structures, but may also exist as loosely associated clusters of cells that work together to perform a specific function or functions. - GO:0009952 Anterior/posterior pattern specification
The regionalization process in which specific areas of cell differentiation are determined along the anterior-posterior axis. The anterior-posterior axis is defined by a line that runs from the head or mouth of an organism to the tail or opposite end of the organism. - GO:0048538 Thymus development
The process whose specific outcome is the progression of the thymus over time, from its formation to the mature structure. The thymus is a symmetric bi-lobed organ involved primarily in the differentiation of immature to mature T cells, with unique vascular, nervous, epithelial, and lymphoid cell components. - GO:0060017 Parathyroid gland development
The process whose specific outcome is the progression of the parathyroid gland over time, from its formation to the mature structure. The parathyroid gland is an organ specialised for secretion of parathyroid hormone. - GO:1900026 Positive regulation of substrate adhesion-dependent cell spreading
Any process that activates or increases the frequency, rate or extent of substrate adhesion-dependent cell spreading.
Protein Sequence
>P47941 MSSARFDSSDRSAWYMGPVTRQEAQTRLQGQRHGMFLVRDSSTCPGDYVLSVSENSRVSHYIINSLPNRRFKIGDQEFDH LPALLEFYKIHYLDTTTLIEPAPRYPSPPVGSVSAPNLPTAEENLEYVRTLYDFPGNDAEDLPFKKGELLVIIEKPEEQW WSARNKDGRVGMIPVPYVEKLVRSSPHGKHGNRNSNSYGIPEPAHAYAQPQTTTPLPTVASTPGAAINPLPSTQNGPVFA KAIQKRVPCAYDKTALALEVGDIVKVTRMNINGQWEGEVNGRKGLFPFTHVKIFDPQNPDDNE