Genome3D
Mus musculus

Bmx Cytoplasmic tyrosine-protein kinase BMX

UniProt Data

Accession P97504 [ UniProt ]
Name BMX_MOUSE
Description Cytoplasmic tyrosine-protein kinase BMX
Species Mus musculus
Sequence Length651

Enzyme Annotations (1)

  • EC:2.7.10.2 Non-specific protein-tyrosine kinase.
    ATP + a [protein]-L-tyrosine = ADP + a [protein]-L-tyrosine phosphate.

GO Annotations

Cellular component (3)

  • GO:0005654 Nucleoplasm
    That part of the nuclear content other than the chromosomes or the nucleolus.
  • GO:0005886 Plasma membrane
    The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
  • GO:0032587 Ruffle membrane
    The portion of the plasma membrane surrounding a ruffle.

Molecular function (1)

None predicted

Biological process (2)

  • GO:0007165 Signal transduction
    The cellular process in which a signal is conveyed to trigger a change in the activity or state of a cell. Signal transduction begins with reception of a signal (e.g. a ligand binding to a receptor or receptor activation by a stimulus such as light), or for signal transduction in the absence of ligand, signal-withdrawal or the activity of a constitutively active receptor. Signal transduction ends with regulation of a downstream cellular process, e.g. regulation of transcription or regulation of a metabolic process. Signal transduction covers signaling from receptors located on the surface of the cell and signaling via molecules located within the cell. For signaling between cells, signal transduction is restricted to events at and within the receiving cell.
  • GO:0046777 Protein autophosphorylation
    The phosphorylation by a protein of one or more of its own amino acid residues (cis-autophosphorylation), or residues on an identical protein (trans-autophosphorylation).

Protein Sequence

>P97504
MESKSILEELLLKKSQQKKKMSPNNYKERLFVLTKTSLSYYEYDKMKRGSRKGSIEIKKIRCVEKVNLEEQTPVERQYPF
QIVYKDGLLYVYASNEESRCQWLKALQKEIRGNPHLLIKYHSGFFVDGKFLCCQQSCKAAPGCTLWEAYADLHIAISDEK
HRAPTFPERLLKIPRAVPVLKMDASSSGAILPQYDSYSKKSCGSQPTSNIRYIPREDCPDWWQVRKLKSEEDIACSNQLE
RNIASHSTSKMSWGFPESSSSEEEENLHAYDWFAGNISRSQSEQLLRQKGKEGAFMVRNSSQMGMYTVSLFSKAVNDKKG
TVKHYHVHTNAENKLYLAENYCFDSIPKLIHYHQHNSAGMITRLRHPVSTKANKVPVSVALGSGIWELKREEITLLKELG
NGQFGVVQLGQWKGQYDVAVKMIKEGAMSEDEFFQEAQTMMKLSHPKLVKFYGVCSKKYPIYIVTEYITNGCLLNYLKSH
GKGLESCQLLEMCYDVCEGMAFLESHQFIHRDLAARNCLVDSDLSVKVSDFGMTRYVLDDQYVSSVGTKFPVKWSAPEVF
HYFKYSSKSDVWAFGILMWEVFSLGKQPYDLYDNSEVVVKVSQGHRLYRPQLASDTIYQIMYSCWHELPEKRPTFQQLLS
AIEPLREQDKP