PTPN11 Tyrosine-protein phosphatase non-receptor type 11

• Overview
• Annotations

UniProt Data

Enzyme Annotations (1)

• EC:3.1.3.48 Protein-tyrosine-phosphatase.
  Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.

GO Annotations

Cellular component (3)

• GO:0005634 Nucleus
  A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
• GO:0005737 Cytoplasm
  All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
• GO:0005829 Cytosol
  The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.

Molecular function (10)

• GO:0004721 Phosphoprotein phosphatase activity
  Catalysis of the reaction: a phosphoprotein + H2O = a protein + phosphate. Together with protein kinases, these enzymes control the state of phosphorylation of cell proteins and thereby provide an important mechanism for regulating cellular activity.
• GO:0004725 Protein tyrosine phosphatase activity
  Catalysis of the reaction: protein tyrosine phosphate + H2O = protein tyrosine + phosphate.
• GO:0004725 Protein tyrosine phosphatase activity
  Catalysis of the reaction: protein tyrosine phosphate + H2O = protein tyrosine + phosphate.
• GO:0004726 Non-membrane spanning protein tyrosine phosphatase activity
  Catalysis of the reaction: non-membrane spanning protein tyrosine phosphate + H2O = non-membrane spanning protein tyrosine + phosphate.
• GO:0004726 Non-membrane spanning protein tyrosine phosphatase activity
  Catalysis of the reaction: non-membrane spanning protein tyrosine phosphate + H2O = non-membrane spanning protein tyrosine + phosphate.
• GO:0005070 SH3/SH2 adaptor activity
  Interacting selectively and non-covalently and simultaneously with one or more signal transduction molecules, usually acting as a scaffold to bring these molecules into close proximity either using their own SH2/SH3 domains (e.g. Grb2) or those of their target molecules (e.g. SAM68).
• GO:0005158 Insulin receptor binding
  Interacting selectively and non-covalently with the insulin receptor.
• GO:0005515 Protein binding
  Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
• GO:0016303 1-phosphatidylinositol-3-kinase activity
  Catalysis of the reaction: 1-phosphatidyl-1D-myo-inositol + ATP = a 1-phosphatidyl-1D-myo-inositol 3-phosphate + ADP + 2 H(+).
• GO:0046934 Phosphatidylinositol-4,5-bisphosphate 3-kinase activity
  Catalysis of the reaction: 1-phosphatidyl-1D-myo-inositol 4,5-bisphosphate + ATP = a 1-phosphatidyl-1D-myo-inositol 3,4,5-trisphosphate + ADP + 2 H(+).

Biological process (24)

• GO:0007173 Epidermal growth factor receptor signaling pathway
  A series of molecular signals initiated by binding of a ligand to the tyrosine kinase receptor EGFR (ERBB1) on the surface of a cell. The pathway ends with regulation of a downstream cellular process, e.g. transcription.
• GO:0007411 Axon guidance
  The chemotaxis process that directs the migration of an axon growth cone to a specific target site in response to a combination of attractive and repulsive cues.
• GO:0007420 Brain development
  The process whose specific outcome is the progression of the brain over time, from its formation to the mature structure. Brain development begins with patterning events in the neural tube and ends with the mature structure that is the center of thought and emotion. The brain is responsible for the coordination and control of bodily activities and the interpretation of information from the senses (sight, hearing, smell, etc.).
• GO:0007507 Heart development
  The process whose specific outcome is the progression of the heart over time, from its formation to the mature structure. The heart is a hollow, muscular organ, which, by contracting rhythmically, keeps up the circulation of the blood.
• GO:0008543 Fibroblast growth factor receptor signaling pathway
  The series of molecular signals generated as a consequence of a fibroblast growth factor receptor binding to one of its physiological ligands.
• GO:0014066 Regulation of phosphatidylinositol 3-kinase signaling
  Any process that modulates the frequency, rate or extent of signal transduction mediated by the phosphatidylinositol 3-kinase cascade.
• GO:0030168 Platelet activation
  A series of progressive, overlapping events triggered by exposure of the platelets to subendothelial tissue. These events include shape change, adhesiveness, aggregation, and release reactions. When carried through to completion, these events lead to the formation of a stable hemostatic plug.
• GO:0031295 T cell costimulation
  The process of providing, via surface-bound receptor-ligand pairs, a second, antigen-independent, signal in addition to that provided by the T cell receptor to augment T cell activation.
• GO:0033628 Regulation of cell adhesion mediated by integrin
  Any process that modulates the frequency, rate, or extent of cell adhesion mediated by integrin.
• GO:0035335 Peptidyl-tyrosine dephosphorylation
  The removal of phosphoric residues from peptidyl-O-phospho-tyrosine to form peptidyl-tyrosine.
• GO:0035335 Peptidyl-tyrosine dephosphorylation
  The removal of phosphoric residues from peptidyl-O-phospho-tyrosine to form peptidyl-tyrosine.
• GO:0036302 Atrioventricular canal development
  The progression of the atrioventricular canal over time, from its formation to the mature structure. The atrioventricular canal is the part of the heart connecting the atrium to the cardiac ventricle.
• GO:0038127 ERBB signaling pathway
  A series of molecular signals initiated by binding of a ligand to a member of the ERBB family of receptor tyrosine kinases on the surface of a cell, and ending with regulation of a downstream cellular process, e.g. transcription.
• GO:0043254 Regulation of protein complex assembly
  Any process that modulates the frequency, rate or extent of protein complex assembly.
• GO:0048013 Ephrin receptor signaling pathway
  The series of molecular signals generated as a consequence of an ephrin receptor binding to an ephrin.
• GO:0048015 Phosphatidylinositol-mediated signaling
  A series of molecular signals in which a cell uses a phosphatidylinositol-mediated signaling to convert a signal into a response. Phosphatidylinositols include phosphatidylinositol (PtdIns) and its phosphorylated derivatives.
• GO:0048806 Genitalia development
  The process whose specific outcome is the progression of the genitalia over time, from its formation to the mature structure.
• GO:0048839 Inner ear development
  The process whose specific outcome is the progression of the inner ear over time, from its formation to the mature structure.
• GO:0050900 Leukocyte migration
  The movement of a leukocyte within or between different tissues and organs of the body.
• GO:0060325 Face morphogenesis
  The process in which the anatomical structures of the face are generated and organized. The face is the ventral division of the head.
• GO:0060338 Regulation of type I interferon-mediated signaling pathway
  Any process that modulates the rate, frequency or extent of a type I interferon-mediated signaling pathway. A type I interferon-mediated signaling pathway is the series of molecular events generated as a consequence of a type I interferon binding to a cell surface receptor.
• GO:0070374 Positive regulation of ERK1 and ERK2 cascade
  Any process that activates or increases the frequency, rate or extent of signal transduction mediated by the ERK1 and ERK2 cascade.
• GO:0071364 Cellular response to epidermal growth factor stimulus
  Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an epidermal growth factor stimulus.
• GO:2001275 Positive regulation of glucose import in response to insulin stimulus
  Any process that activates or increases the frequency, rate or extent of glucose import in response to insulin stimulus.

Protein Sequence

>Q06124
MTSRRWFHPNITGVEAENLLLTRGVDGSFLARPSKSNPGDFTLSVRRNGAVTHIKIQNTGDYYDLYGGEKFATLAELVQY
YMEHHGQLKEKNGDVIELKYPLNCADPTSERWFHGHLSGKEAEKLLTEKGKHGSFLVRESQSHPGDFVLSVRTGDDKGES
NDGKSKVTHVMIRCQELKYDVGGGERFDSLTDLVEHYKKNPMVETLGTVLQLKQPLNTTRINAAEIESRVRELSKLAETT
DKVKQGFWEEFETLQQQECKLLYSRKEGQRQENKNKNRYKNILPFDHTRVVLHDGDPNEPVSDYINANIIMPEFETKCNN
SKPKKSYIATQGCLQNTVNDFWRMVFQENSRVIVMTTKEVERGKSKCVKYWPDEYALKEYGVMRVRNVKESAAHDYTLRE
LKLSKVGQALLQGNTERTVWQYHFRTWPDHGVPSDPGGVLDFLEEVHHKQESIMDAGPVVVHCSAGIGRTGTFIVIDILI
DIIREKGVDCDIDVPKTIQMVRSQRSGMVQTEAQYRFIYMAVQHYIETLQRRIEEEQKSKRKGHEYTNIKYSLADQTSGD
QSPLPPCTPTPPCAEMREDSARVYENVGLMQQQKSFR