Genome3D
Saccharomyces cerevisiae S288C

PIN3 [PSI+] inducibility protein 3

UniProt Data

Accession Q06449 [ UniProt ]
Name PIN3_YEAST
Description [PSI+] inducibility protein 3
Species Saccharomyces cerevisiae S288C
Sequence Length215

Enzyme Annotations (0)

    GO Annotations

    Cellular component (2)

    • GO:0005737 Cytoplasm
      All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    • GO:0030479 Actin cortical patch
      An endocytic patch that consists of an actin-containing structure found at the plasma membrane in cells; formed of networks of branched actin filaments that lie just beneath the plasma membrane and assemble, move, and disassemble rapidly. An example of this is the actin cortical patch found in Saccharomyces cerevisiae.

    Molecular function (1)

    None predicted

    Biological process (2)

    • GO:0034316 Negative regulation of Arp2/3 complex-mediated actin nucleation
      Any process that stops, prevents, or reduces the frequency, rate or extent of actin nucleation mediated by the Arp2/3 complex and interacting proteins.
    • GO:0034316 Negative regulation of Arp2/3 complex-mediated actin nucleation
      Any process that stops, prevents, or reduces the frequency, rate or extent of actin nucleation mediated by the Arp2/3 complex and interacting proteins.

    Protein Sequence

    >Q06449
MSASLINRSLTNIRTELDFLKGSNVISNDVYDQINKSLPAKWDPANAPRNASPASLEYVEALYQFDPQQDGDLGLKPGDK
VQLLEKLSPEWYKGSCNGRTGIFPANYVKPAFSGSNGPSNLPPPPQYKAQELQQIPTQNSAASSYQQQPFPPPSTNYYQQ
PQQQPQQAPPPQQQQQQQQHQSSHSHLKSFGSKLGNAAIFGAGASIGSDIVNNIF