Genome3D
Mus musculus

Sh2d1b2 SH2 domain-containing protein 1B2

UniProt Data

Accession Q45HK4 [ UniProt ]
Name SH21C_MOUSE
Description SH2 domain-containing protein 1B2
Species Mus musculus
Sequence Length132

Enzyme Annotations (0)

    GO Annotations

    Cellular component (1)

    None predicted

    Molecular function (1)

    None predicted

    Biological process (5)

    • GO:0018108 Peptidyl-tyrosine phosphorylation
      The phosphorylation of peptidyl-tyrosine to form peptidyl-O4'-phospho-L-tyrosine.
    • GO:0032814 Regulation of natural killer cell activation
      Any process that modulates the frequency, rate or extent of natural killer cell activation.
    • GO:0045953 Negative regulation of natural killer cell mediated cytotoxicity
      Any process that stops, prevents, or reduces the rate of natural killer mediated cytotoxicity.
    • GO:0045954 Positive regulation of natural killer cell mediated cytotoxicity
      Any process that activates or increases the frequency, rate or extent of natural killer cell mediated cytotoxicity.
    • GO:0050731 Positive regulation of peptidyl-tyrosine phosphorylation
      Any process that activates or increases the frequency, rate or extent of the phosphorylation of peptidyl-tyrosine.

    Protein Sequence

    >Q45HK4
MDLPYYHGCLTKRECEALLLKGGVDGNFLIRDSESVPGALCLCVSFKKLVYNYRIFREKNGYYRIETEPSTPKTIFPNLE
ELISKFKTPGQGMVVHLSNPIMRSGFCPGARRLNLEANVYENTDEEYVDVLP