Mus musculus

UniProt Data

Accession Q60631 [ UniProt ]
Name GRB2_MOUSE
Description Growth factor receptor-bound protein 2
Species Mus musculus
Sequence Length217

Enzyme Annotations (0)

    GO Annotations

    Cellular component (17)

    • GO:0005634 Nucleus
      A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
    • GO:0005634 Nucleus
      A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
    • GO:0005654 Nucleoplasm
      That part of the nuclear content other than the chromosomes or the nucleolus.
    • GO:0005730 Nucleolus
      A small, dense body one or more of which are present in the nucleus of eukaryotic cells. It is rich in RNA and protein, is not bounded by a limiting membrane, and is not seen during mitosis. Its prime function is the transcription of the nucleolar DNA into 45S ribosomal-precursor RNA, the processing of this RNA into 5.8S, 18S, and 28S components of ribosomal RNA, and the association of these components with 5S RNA and proteins synthesized outside the nucleolus. This association results in the formation of ribonucleoprotein precursors; these pass into the cytoplasm and mature into the 40S and 60S subunits of the ribosome.
    • GO:0005737 Cytoplasm
      All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    • GO:0005737 Cytoplasm
      All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    • GO:0005768 Endosome
      A vacuole to which materials ingested by endocytosis are delivered.
    • GO:0005768 Endosome
      A vacuole to which materials ingested by endocytosis are delivered.
    • GO:0005829 Cytosol
      The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
    • GO:0005886 Plasma membrane
      The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
    • GO:0005911 Cell-cell junction
      A cell junction that forms a connection between two or more cells in a multicellular organism; excludes direct cytoplasmic junctions such as ring canals.
    • GO:0008180 COP9 signalosome
      A protein complex that catalyzes the deneddylation of proteins, including the cullin component of SCF ubiquitin E3 ligase; deneddylation increases the activity of cullin family ubiquitin ligases. The signalosome is involved in many regulatory process, including some which control development, in many species; also regulates photomorphogenesis in plants; in many species its subunits are highly similar to those of the proteasome.
    • GO:0008180 COP9 signalosome
      A protein complex that catalyzes the deneddylation of proteins, including the cullin component of SCF ubiquitin E3 ligase; deneddylation increases the activity of cullin family ubiquitin ligases. The signalosome is involved in many regulatory process, including some which control development, in many species; also regulates photomorphogenesis in plants; in many species its subunits are highly similar to those of the proteasome.
    • GO:0012506 Vesicle membrane
      The lipid bilayer surrounding any membrane-bounded vesicle in the cell.
    • GO:0016020 Membrane
      A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    • GO:0070062 Extracellular exosome
      A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
    • GO:0070436 Grb2-EGFR complex
      A protein complex that contains the epidermal growth factor receptor (EGFR) and Grb2, and is involved in linking EGFR activation to the p21-Ras pathway.

    Molecular function (15)

    • GO:0001784 Phosphotyrosine binding
      Interacting selectively and non-covalently with a phosphorylated tyrosine residue within a protein.
    • GO:0003723 RNA binding
      Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    • GO:0005070 SH3/SH2 adaptor activity
      Interacting selectively and non-covalently and simultaneously with one or more signal transduction molecules, usually acting as a scaffold to bring these molecules into close proximity either using their own SH2/SH3 domains (e.g. Grb2) or those of their target molecules (e.g. SAM68).
    • GO:0005154 Epidermal growth factor receptor binding
      Interacting selectively and non-covalently with the epidermal growth factor receptor.
    • GO:0005168 Neurotrophin TRKA receptor binding
      Interacting selectively and non-covalently with the neurotrophin TRKA receptor.
    • GO:0005515 Protein binding
      Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    • GO:0017124 SH3 domain binding
      Interacting selectively and non-covalently with a SH3 domain (Src homology 3) of a protein, small protein modules containing approximately 50 amino acid residues found in a great variety of intracellular or membrane-associated proteins.
    • GO:0017124 SH3 domain binding
      Interacting selectively and non-covalently with a SH3 domain (Src homology 3) of a protein, small protein modules containing approximately 50 amino acid residues found in a great variety of intracellular or membrane-associated proteins.
    • GO:0019901 Protein kinase binding
      Interacting selectively and non-covalently with a protein kinase, any enzyme that catalyzes the transfer of a phosphate group, usually from ATP, to a protein substrate.
    • GO:0019903 Protein phosphatase binding
      Interacting selectively and non-covalently with any protein phosphatase.
    • GO:0019904 Protein domain specific binding
      Interacting selectively and non-covalently with a specific domain of a protein.
    • GO:0042802 Identical protein binding
      Interacting selectively and non-covalently with an identical protein or proteins.
    • GO:0043560 Insulin receptor substrate binding
      Interacting selectively and non-covalently with any of the insulin receptor substrate (IRS) proteins, adaptor proteins that bind to the transphosphorylated insulin and insulin-like growth factor receptors, are themselves phosphorylated and in turn recruit SH2 domain-containing signaling molecules to form a productive signaling complex.
    • GO:0046875 Ephrin receptor binding
      Interacting selectively and non-covalently with an ephrin receptor.
    • GO:0046875 Ephrin receptor binding
      Interacting selectively and non-covalently with an ephrin receptor.

    Biological process (12)

    • GO:0007265 Ras protein signal transduction
      A series of molecular signals within the cell that are mediated by a member of the Ras superfamily of proteins switching to a GTP-bound active state.
    • GO:0008286 Insulin receptor signaling pathway
      The series of molecular signals generated as a consequence of the insulin receptor binding to insulin.
    • GO:0030154 Cell differentiation
      The process in which relatively unspecialized cells, e.g. embryonic or regenerative cells, acquire specialized structural and/or functional features that characterize the cells, tissues, or organs of the mature organism or some other relatively stable phase of the organism's life history. Differentiation includes the processes involved in commitment of a cell to a specific fate and its subsequent development to the mature state.
    • GO:0030838 Positive regulation of actin filament polymerization
      Any process that activates or increases the frequency, rate or extent of actin polymerization.
    • GO:0031623 Receptor internalization
      A receptor-mediated endocytosis process that results in the movement of receptors from the plasma membrane to the inside of the cell. The process begins when cell surface receptors are monoubiquitinated following ligand-induced activation. Receptors are subsequently taken up into endocytic vesicles from where they are either targeted to the lysosome or vacuole for degradation or recycled back to the plasma membrane.
    • GO:0038095 Fc-epsilon receptor signaling pathway
      A series of molecular signals initiated by the binding of the Fc portion of immunoglobulin E (IgE) to an Fc-epsilon receptor on the surface of a signal-receiving cell, and ending with regulation of a downstream cellular process, e.g. transcription. The Fc portion of an immunoglobulin is its C-terminal constant region.
    • GO:0042770 Signal transduction in response to DNA damage
      A cascade of processes induced by the detection of DNA damage within a cell.
    • GO:0043408 Regulation of MAPK cascade
      Any process that modulates the frequency, rate or extent of signal transduction mediated by the MAP kinase (MAPK) cascade.
    • GO:0048646 Anatomical structure formation involved in morphogenesis
      The developmental process pertaining to the initial formation of an anatomical structure from unspecified parts. This process begins with the specific processes that contribute to the appearance of the discrete structure and ends when the structural rudiment is recognizable. An anatomical structure is any biological entity that occupies space and is distinguished from its surroundings. Anatomical structures can be macroscopic such as a carpel, or microscopic such as an acrosome.
    • GO:0060670 Branching involved in labyrinthine layer morphogenesis
      The process in which the branches of the fetal placental villi are generated and organized. The villous part of the placenta is called the labyrinth layer.
    • GO:0071479 Cellular response to ionizing radiation
      Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a ionizing radiation stimulus. Ionizing radiation is radiation with sufficient energy to remove electrons from atoms and may arise from spontaneous decay of unstable isotopes, resulting in alpha and beta particles and gamma rays. Ionizing radiation also includes X-rays.
    • GO:2000379 Positive regulation of reactive oxygen species metabolic process
      Any process that activates or increases the frequency, rate or extent of reactive oxygen species metabolic process.

    Protein Sequence

    >Q60631
    MEAIAKYDFKATADDELSFKRGDILKVLNEECDQNWYKAELNGKDGFIPKNYIEMKPHPWFFGKIPRAKAEEMLSKQRHD
    GAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVVKFNSLNELVDYHRSTSVSRNQQIFLRDIEQMPQQPTY
    VQALFDFDPQEDGELGFRRGDFIHVMDNSDPNWWKGACHGQTGMFPRNYVTPVNRNV