Genome3D
Mus musculus

Vav2 Guanine nucleotide exchange factor VAV2

UniProt Data

Accession Q60992 [ UniProt ]
Name VAV2_MOUSE
Description Guanine nucleotide exchange factor VAV2
Species Mus musculus
Sequence Length868

Enzyme Annotations (0)

    GO Annotations

    Cellular component (3)

    • GO:0005737 Cytoplasm
      All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    • GO:0005829 Cytosol
      The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
    • GO:0005886 Plasma membrane
      The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

    Molecular function (5)

    • GO:0001784 Phosphotyrosine binding
      Interacting selectively and non-covalently with a phosphorylated tyrosine residue within a protein.
    • GO:0005085 Guanyl-nucleotide exchange factor activity
      Stimulates the exchange of guanyl nucleotides associated with a GTPase. Under normal cellular physiological conditions, the concentration of GTP is higher than that of GDP, favoring the replacement of GDP by GTP in association with the GTPase.
    • GO:0005085 Guanyl-nucleotide exchange factor activity
      Stimulates the exchange of guanyl nucleotides associated with a GTPase. Under normal cellular physiological conditions, the concentration of GTP is higher than that of GDP, favoring the replacement of GDP by GTP in association with the GTPase.
    • GO:0005154 Epidermal growth factor receptor binding
      Interacting selectively and non-covalently with the epidermal growth factor receptor.
    • GO:0005515 Protein binding
      Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).

    Biological process (9)

    • GO:0007264 Small GTPase mediated signal transduction
      Any series of molecular signals in which a small monomeric GTPase relays one or more of the signals.
    • GO:0010468 Regulation of gene expression
      Any process that modulates the frequency, rate or extent of gene expression. Gene expression is the process in which a gene's coding sequence is converted into a mature gene product or products (proteins or RNA). This includes the production of an RNA transcript as well as any processing to produce a mature RNA product or an mRNA (for protein-coding genes) and the translation of that mRNA into protein. Protein maturation is included when required to form an active form of a product from an inactive precursor form.
    • GO:0016477 Cell migration
      The controlled self-propelled movement of a cell from one site to a destination guided by molecular cues. Cell migration is a central process in the development and maintenance of multicellular organisms.
    • GO:0030031 Cell projection assembly
      Formation of a prolongation or process extending from a cell, e.g. a flagellum or axon.
    • GO:0030032 Lamellipodium assembly
      Formation of a lamellipodium, a thin sheetlike extension of the surface of a migrating cell.
    • GO:0030168 Platelet activation
      A series of progressive, overlapping events triggered by exposure of the platelets to subendothelial tissue. These events include shape change, adhesiveness, aggregation, and release reactions. When carried through to completion, these events lead to the formation of a stable hemostatic plug.
    • GO:0030193 Regulation of blood coagulation
      Any process that modulates the frequency, rate or extent of blood coagulation.
    • GO:0043087 Regulation of GTPase activity
      Any process that modulates the rate of GTP hydrolysis by a GTPase.
    • GO:0043552 Positive regulation of phosphatidylinositol 3-kinase activity
      Any process that activates or increases the frequency, rate or extent of phosphatidylinositol 3-kinase activity.

    Protein Sequence

    >Q60992
MEQWRQCGRWLIDCKVLPPNHRVVWPSAVVFDLAQALRDGVLLCQLLHNLSPGSIDLKDINFRPQMSQFLCLKNIRTFLK
VCHDKFGLRNSELFDPFDLFDVRDFGKVISAVSRLSLHSIAQSKGIRPFPSEETAENDDDVYRSLEELADEHDLGEDIYD
CVPCEDEGDDIYEDIIKVEVQQPMKMGMTEDDKRSCCLLEIQETEAKYYRTLEDIEKNYMGPLRLVLSPADMAAVFINLE
DLIKVHHSFLRAIDVSMMAGGSTLAKVFLEFKERLLIYGEYCSHMEHAQSTLNQLLASREDFRQKVEECTLRVQDGKFKL
QDLLVVPMQRVLKYHLLLKELLSHSADRPERQQLKEALEAMQDLAMYINEVKRDKETLKKISEFQCSIENLQVKLEEFGR
PKIDGELKVRSIVNHTKQDRYLFLFDKVVIVCKRKGYSYELKEVIELLFHKMTDDPMHNKDIKKWSYGFYLIHLQGKQGF
QFFCKTEDMKRKWMEQFEMAMSNIKPDKANANHHSFQMYTFDKTTNCKACKMFLRGTFYQGYLCTRCGVGAHKECLEVIP
PCKMSSPADVDAPGAGPGPKMVAVQNYHGNPAPPGKPVLTFQTGDVIELLRGDPDSPWWEGRLVQTRKSGYFPSSSVKPC
PVDGRPPTGRPPSREIDYTAYPWFAGNMERQQTDNLLKSHASGTYLIRERPAEAERFAISIKFNDEVKHIKVVEKDSWIH
ITEAKKFESLLELVEYYQCHSLKESFKQLDTTLKFPYKSRERTTSRASSRSPASCASYNFSFLSPQGLSFAPQAPSAPFW
SVFTPRVIGTAVARYNFAARDMRELSLREGDVVKIYSRIGGDQGWWKGETNGRIGWFPSTYVEEEGVQ