Genome3D
Mus musculus

Crk Adapter molecule crk

UniProt Data

Accession Q64010 [ UniProt ]
Name CRK_MOUSE
Description Adapter molecule crk
Species Mus musculus
Sequence Length304

Enzyme Annotations (0)

    GO Annotations

    Cellular component (4)

    • GO:0015629 Actin cytoskeleton
      The part of the cytoskeleton (the internal framework of a cell) composed of actin and associated proteins. Includes actin cytoskeleton-associated complexes.
    • GO:0043234 Protein complex
      A stable macromolecular complex composed (only) of two or more polypeptide subunits along with any covalently attached molecules (such as lipid anchors or oligosaccharide) or non-protein prosthetic groups (such as nucleotides or metal ions). Prosthetic group in this context refers to a tightly bound cofactor. The component polypeptide subunits may be identical.
    • GO:0043234 Protein complex
      A stable macromolecular complex composed (only) of two or more polypeptide subunits along with any covalently attached molecules (such as lipid anchors or oligosaccharide) or non-protein prosthetic groups (such as nucleotides or metal ions). Prosthetic group in this context refers to a tightly bound cofactor. The component polypeptide subunits may be identical.
    • GO:0070062 Extracellular exosome
      A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.

    Molecular function (13)

    • GO:0001784 Phosphotyrosine binding
      Interacting selectively and non-covalently with a phosphorylated tyrosine residue within a protein.
    • GO:0005070 SH3/SH2 adaptor activity
      Interacting selectively and non-covalently and simultaneously with one or more signal transduction molecules, usually acting as a scaffold to bring these molecules into close proximity either using their own SH2/SH3 domains (e.g. Grb2) or those of their target molecules (e.g. SAM68).
    • GO:0005070 SH3/SH2 adaptor activity
      Interacting selectively and non-covalently and simultaneously with one or more signal transduction molecules, usually acting as a scaffold to bring these molecules into close proximity either using their own SH2/SH3 domains (e.g. Grb2) or those of their target molecules (e.g. SAM68).
    • GO:0005515 Protein binding
      Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    • GO:0017124 SH3 domain binding
      Interacting selectively and non-covalently with a SH3 domain (Src homology 3) of a protein, small protein modules containing approximately 50 amino acid residues found in a great variety of intracellular or membrane-associated proteins.
    • GO:0042169 SH2 domain binding
      Interacting selectively and non-covalently with a SH2 domain (Src homology 2) of a protein, a protein domain of about 100 amino-acid residues and belonging to the alpha + beta domain class.
    • GO:0042169 SH2 domain binding
      Interacting selectively and non-covalently with a SH2 domain (Src homology 2) of a protein, a protein domain of about 100 amino-acid residues and belonging to the alpha + beta domain class.
    • GO:0043621 Protein self-association
      Interacting selectively and non-covalently with a domain within the same polypeptide.
    • GO:0045309 Protein phosphorylated amino acid binding
      Interacting selectively and non-covalently with a phosphorylated amino acid residue within a protein.
    • GO:0045309 Protein phosphorylated amino acid binding
      Interacting selectively and non-covalently with a phosphorylated amino acid residue within a protein.
    • GO:0046875 Ephrin receptor binding
      Interacting selectively and non-covalently with an ephrin receptor.
    • GO:0046875 Ephrin receptor binding
      Interacting selectively and non-covalently with an ephrin receptor.
    • GO:1990782 Protein tyrosine kinase binding
      Interacting selectively and non-covalently with protein tyrosine kinase.

    Biological process (16)

    • GO:0008360 Regulation of cell shape
      Any process that modulates the surface configuration of a cell.
    • GO:0009966 Regulation of signal transduction
      Any process that modulates the frequency, rate or extent of signal transduction.
    • GO:0030307 Positive regulation of cell growth
      Any process that activates or increases the frequency, rate, extent or direction of cell growth.
    • GO:0032956 Regulation of actin cytoskeleton organization
      Any process that modulates the frequency, rate or extent of the formation, arrangement of constituent parts, or disassembly of cytoskeletal structures comprising actin filaments and their associated proteins.
    • GO:0032956 Regulation of actin cytoskeleton organization
      Any process that modulates the frequency, rate or extent of the formation, arrangement of constituent parts, or disassembly of cytoskeletal structures comprising actin filaments and their associated proteins.
    • GO:0032956 Regulation of actin cytoskeleton organization
      Any process that modulates the frequency, rate or extent of the formation, arrangement of constituent parts, or disassembly of cytoskeletal structures comprising actin filaments and their associated proteins.
    • GO:0043087 Regulation of GTPase activity
      Any process that modulates the rate of GTP hydrolysis by a GTPase.
    • GO:0043087 Regulation of GTPase activity
      Any process that modulates the rate of GTP hydrolysis by a GTPase.
    • GO:0043393 Regulation of protein binding
      Any process that modulates the frequency, rate or extent of protein binding.
    • GO:0048013 Ephrin receptor signaling pathway
      The series of molecular signals generated as a consequence of an ephrin receptor binding to an ephrin.
    • GO:0048013 Ephrin receptor signaling pathway
      The series of molecular signals generated as a consequence of an ephrin receptor binding to an ephrin.
    • GO:0061045 Negative regulation of wound healing
      Any process that decreases the rate, frequency, or extent of the series of events that restore integrity to a damaged tissue, following an injury.
    • GO:0071538 SH2 domain-mediated complex assembly
      A process of protein complex assembly in which the arrangement and bonding together of the set of components that form the protein complex is mediated by an SH2 domain interaction.
    • GO:1900026 Positive regulation of substrate adhesion-dependent cell spreading
      Any process that activates or increases the frequency, rate or extent of substrate adhesion-dependent cell spreading.
    • GO:1900026 Positive regulation of substrate adhesion-dependent cell spreading
      Any process that activates or increases the frequency, rate or extent of substrate adhesion-dependent cell spreading.
    • GO:2000146 Negative regulation of cell motility
      Any process that stops, prevents, or reduces the frequency, rate or extent of cell motility.

    Protein Sequence

    >Q64010
MAGNFDSEERSSWYWGRLSRQEAVALLQGQRHGVFLVRDSSTSPGDYVLSVSENSRVSHYIINSSGPRPPVPPSPAQPPP
GVSPSRLRIGDQEFDSLPALLEFYKIHYLDTTTLIEPVARSRQGSGVILRQEEAEYVRALFDFNGNDEEDLPFKKGDILR
IRDKPEEQWWNAEDSEGKRGMIPVPYVEKYRPASASVSALIGGNQEGSHPQPLGGPEPGPYAQPSVNTPLPNLQNGPIYA
RVIQKRVPNAYDKTALALEVGELVKVTKINVSGQWEGECNGKRGHFPFTHVRLLDQQNPDEDFS