Pik3r3 Phosphatidylinositol 3-kinase regulatory subunit gamma
UniProt Data
Accession | Q64143 [ UniProt ] |
Name | P55G_MOUSE |
Description | Phosphatidylinositol 3-kinase regulatory subunit gamma |
Species | Mus musculus |
Sequence Length | 461 |
Enzyme Annotations (0)
GO Annotations
Cellular component (1)
None predictedMolecular function (3)
- GO:0001784 Phosphotyrosine binding
Interacting selectively and non-covalently with a phosphorylated tyrosine residue within a protein. - GO:0005515 Protein binding
Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules). - GO:0046935 1-phosphatidylinositol-3-kinase regulator activity
Modulates the activity of the enzyme 1-phosphatidylinositol-3-kinase activity.
Biological process (2)
- GO:0008286 Insulin receptor signaling pathway
The series of molecular signals generated as a consequence of the insulin receptor binding to insulin. - GO:2001275 Positive regulation of glucose import in response to insulin stimulus
Any process that activates or increases the frequency, rate or extent of glucose import in response to insulin stimulus.
Protein Sequence
>Q64143 MYNTVWSMDRDDADWREVMMPYSTELIFYIEMDPPALPPKPPKPMTPAVTNGMKDSFISLQDAEWYWGDISREEVNDKLR DMPDGTFLVRDASTKMQGDYTLTLRKGGNNKLIKIYHRDGKYGFSEPLTFTSVVELINHYHHESLAQYNPKLDVKLTYPV SRFQQDQLVKEDNIDAVGKNLQEFHSQYQEKSKEYDRLYEEYTRTSQEIQMKRTAIEAFNETIKIFEEQCHTQEQHSKDY IERFRREGNEKEIERIMMNYDKLKSRLGEIHDSKLRLEQDLKKQALDNREIDKKMNSIKPDLIQLRKIRDQHLVWLNHRG VRQRRLNAWLGIKNEDSDESYFINEEDENLPHYDEKTWFVEDINRVQAEDLLYGKPDGAFLIRESSKKGCYACSVVADGE VKHCVIYSTARGYGFAEPYNLYSSLKELVLHYQQTSLVQHNDSLNVRLAYPVHAQMPTLCR