Ptk6 Protein-tyrosine kinase 6

• Overview
• Annotations

UniProt Data

Enzyme Annotations (1)

• EC:2.7.10.2 Non-specific protein-tyrosine kinase.
  ATP + a [protein]-L-tyrosine = ADP + a [protein]-L-tyrosine phosphate.

GO Annotations

Cellular component (8)

• GO:0001726 Ruffle
  Projection at the leading edge of a crawling cell; the protrusions are supported by a microfilament meshwork.
• GO:0005634 Nucleus
  A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
• GO:0005634 Nucleus
  A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
• GO:0005654 Nucleoplasm
  That part of the nuclear content other than the chromosomes or the nucleolus.
• GO:0005737 Cytoplasm
  All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
• GO:0005829 Cytosol
  The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
• GO:0005886 Plasma membrane
  The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
• GO:0016604 Nuclear body
  Extra-nucleolar nuclear domains usually visualized by confocal microscopy and fluorescent antibodies to specific proteins.

Molecular function (3)

• GO:0004713 Protein tyrosine kinase activity
  Catalysis of the reaction: ATP + a protein tyrosine = ADP + protein tyrosine phosphate.
• GO:0004715 Non-membrane spanning protein tyrosine kinase activity
  Catalysis of the reaction: ATP + protein L-tyrosine = ADP + protein L-tyrosine phosphate by a non-membrane spanning protein.
• GO:0042802 Identical protein binding
  Interacting selectively and non-covalently with an identical protein or proteins.

Biological process (10)

• GO:0007260 Tyrosine phosphorylation of STAT protein
  The process of introducing a phosphate group to a tyrosine residue of a STAT (Signal Transducer and Activator of Transcription) protein.
• GO:0007260 Tyrosine phosphorylation of STAT protein
  The process of introducing a phosphate group to a tyrosine residue of a STAT (Signal Transducer and Activator of Transcription) protein.
• GO:0010976 Positive regulation of neuron projection development
  Any process that increases the rate, frequency or extent of neuron projection development. Neuron projection development is the process whose specific outcome is the progression of a neuron projection over time, from its formation to the mature structure. A neuron projection is any process extending from a neural cell, such as axons or dendrites (collectively called neurites).
• GO:0016477 Cell migration
  The controlled self-propelled movement of a cell from one site to a destination guided by molecular cues. Cell migration is a central process in the development and maintenance of multicellular organisms.
• GO:0045926 Negative regulation of growth
  Any process that stops, prevents or reduces the rate or extent of growth, the increase in size or mass of all or part of an organism.
• GO:0046777 Protein autophosphorylation
  The phosphorylation by a protein of one or more of its own amino acid residues (cis-autophosphorylation), or residues on an identical protein (trans-autophosphorylation).
• GO:0046777 Protein autophosphorylation
  The phosphorylation by a protein of one or more of its own amino acid residues (cis-autophosphorylation), or residues on an identical protein (trans-autophosphorylation).
• GO:0060575 Intestinal epithelial cell differentiation
  The process in which a relatively unspecialized cell acquires specialized features of a columnar/cuboidal epithelial cell of the intestine.
• GO:0061099 Negative regulation of protein tyrosine kinase activity
  Any process that decreases the rate, frequency, or extent of protein tyrosine kinase activity.
• GO:0071300 Cellular response to retinoic acid
  Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a retinoic acid stimulus.

Protein Sequence

>Q64434
MVSWDKAHLGPKYVGLWDFKARTDEELSFQAGDLLHVTKKEELWWWATLLDAEGKALAEGYVPHNYLAEKETVESEPWFF
GCISRSEAMHRLQAEDNSKGAFLIRVSQKPGADYVLSVRDAQAVRHYRIWKNNEGRLHLNEAVSFSNLSELVDYHKTQSL
SHGLQLSMPCWKHKTEPLPHWDDWERPREEFTLCKKLGAGYFGEVFEALWKGQVHVAVKVISRDNLLHQHTFQAEIQAMK
KLRHKHILSLYAVATAGDPVYIITELMPKGNLLQLLRDSDEKALPILELVDFASQVAEGMCYLESQNYIHRDLAARNVLV
TENNLCKVGDFGLARLVKEDIYLSHEHNVPYKWTAPEALSRGHYSIKSDVWSFGVLLHEIFSRGQMPYPGMSNHETFLRV
DAGYRMPCPLECPPNIHKLMLSCWSRDPKQRPCFKDLCEKLTGITRYENLV