Genome3D
Drosophila melanogaster

Dap160 Dynamin associated protein 160, isoform B

UniProt Data

Accession Q8INU2 [ UniProt ]
Name Q8INU2_DROME
Description Dynamin associated protein 160, isoform B
Species Drosophila melanogaster
Sequence Length1014

Enzyme Annotations (0)

    GO Annotations

    Cellular component (4)

    • GO:0005737 Cytoplasm
      All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    • GO:0005886 Plasma membrane
      The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
    • GO:0008021 Synaptic vesicle
      A secretory organelle, typically 50 nm in diameter, of presynaptic nerve terminals; accumulates in high concentrations of neurotransmitters and secretes these into the synaptic cleft by fusion with the 'active zone' of the presynaptic plasma membrane.
    • GO:0045179 Apical cortex
      The region that lies just beneath the plasma membrane on the apical edge of a cell.

    Molecular function (1)

    None predicted

    Biological process (8)

    • GO:0002052 Positive regulation of neuroblast proliferation
      Any process that activates or increases the rate of neuroblast proliferation.
    • GO:0007269 Neurotransmitter secretion
      The regulated release of neurotransmitter from the presynapse into the synaptic cleft via calcium regualated exocytosis during synaptic transmission.
    • GO:0008104 Protein localization
      Any process in which a protein is transported to, or maintained in, a specific location.
    • GO:0045746 Negative regulation of Notch signaling pathway
      Any process that stops, prevents, or reduces the frequency, rate or extent of the Notch signaling pathway.
    • GO:0045860 Positive regulation of protein kinase activity
      Any process that activates or increases the frequency, rate or extent of protein kinase activity.
    • GO:0048488 Synaptic vesicle endocytosis
      Clathrin-mediated endocytosis of presynaptic membrane that recycles synaptic vesicle membrane and its components following synaptic vesicle exocytosis. This process starts with coating of the membrane with adaptor proteins and clathrin prior to invagination and ends when uncoating has finished.
    • GO:0048488 Synaptic vesicle endocytosis
      Clathrin-mediated endocytosis of presynaptic membrane that recycles synaptic vesicle membrane and its components following synaptic vesicle exocytosis. This process starts with coating of the membrane with adaptor proteins and clathrin prior to invagination and ends when uncoating has finished.
    • GO:0051124 Synaptic growth at neuromuscular junction
      The growth of a synapse at a neuromuscular junction, the site of apposition of a motor end plate and the subneural cleft of the skeletal muscle fiber that it innervates.

    Protein Sequence

    >Q8INU2
MNSAVDAWAVTPRERLKYQEQFRALQPQAGFVTGAQAKGFFLQSQLPPLILGQIWALADTDSDGKMNINEFSIACKLINL
KLRGMDVPKVLPPSLLSSLTGDVPSMTPRGSTSSLSPLDPLKGIVPAVAPVVPVVAPPVAVATVISPPGVSVPSGPTPPT
SNPPSRHTSISERAPSIESVNQGEWAVQAAQKRKYTQVFNANDRTRSGYLTGSQARGVLVQSKLPQVTLAQIWTLSDIDG
DGRLNCDEFILAMFLCEKAMAGEKIPVTLPQEWVPPNLRKIKSRPGSVSGVVSRPGSQPASRHASVSSQSGVGVVDADPT
AGLPGQTSFEDKRKENYVKGQAELDRRRKIMEDQQRKEREERERKEREEADKREKARLEAERKQQEELERQLQRQREIEM
EKEEQRKRELEAKEAARKELEKQRQQEWEQARIAEMNAQKEREQERVLKQKAHNTQLNVELSTLNEKIKELSQRICDTRA
GVTNVKTVIDGMRTQRDTSMSEMSQLKARIKEQNAKLLQLTQERAKWEAKSKASGAALGGENAQQEQLNAAFAHKQLIIN
QIKDKVENISKEIESKKEDINTNDVQMSELKAELSALITKCEDLYKEYDVQRTSVLELKYNRKNETSVSSAWDTGSSSAW
EETGTTVTDPYAVASNDISALAAPAVDLGGPAPEGFVKYQAVYEFNARNAEEITFVPGDIILVPLEQNAEPGWLAGEING
HTGWFPESYVEKLEVGEVAPVAAVEAPVDAQVATVADTYNDNINTSSIPAASADLTAAGDVEYYIAAYPYESAEEGDLSF
SAGEMVMVIKKEGEWWTGTIGSRTGMFPSNYVQKADVGTASTAAAEPVESLDQGMRAKRSEIAQVIAPYEATSTEQLSLT
RGQLIMIRKKTDSGWWEGELQAKGRRRQIGWFPATYVKVLQGGRNSGRNTPVSGSRIEMTEQILDKVIALYPYKAQNDDE
LSFDKDDIISVLGRDEPEWWRGELNGLSGLFPSNYVGPFVTSGKPAKANGTTKK