Genome3D
Mus musculus

Sh3d19 SH3 domain-containing protein 19

UniProt Data

Accession Q91X43 [ UniProt ]
Name SH319_MOUSE
Description SH3 domain-containing protein 19
Species Mus musculus
Sequence Length789

Enzyme Annotations (0)

    GO Annotations

    Cellular component (3)

    • GO:0005654 Nucleoplasm
      That part of the nuclear content other than the chromosomes or the nucleolus.
    • GO:0005829 Cytosol
      The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
    • GO:0005886 Plasma membrane
      The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

    Molecular function (2)

    • GO:0005515 Protein binding
      Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    • GO:0070064 Proline-rich region binding
      Interacting selectively and non-covalently with a proline-rich region, i.e. a region that contains a high proportion of proline residues, in a protein.

    Biological process (5)

    • GO:0007010 Cytoskeleton organization
      A process that is carried out at the cellular level which results in the assembly, arrangement of constituent parts, or disassembly of cytoskeletal structures.
    • GO:0007010 Cytoskeleton organization
      A process that is carried out at the cellular level which results in the assembly, arrangement of constituent parts, or disassembly of cytoskeletal structures.
    • GO:0022604 Regulation of cell morphogenesis
      Any process that modulates the frequency, rate or extent of cell morphogenesis. Cell morphogenesis is the developmental process in which the shape of a cell is generated and organized.
    • GO:0022604 Regulation of cell morphogenesis
      Any process that modulates the frequency, rate or extent of cell morphogenesis. Cell morphogenesis is the developmental process in which the shape of a cell is generated and organized.
    • GO:0051044 Positive regulation of membrane protein ectodomain proteolysis
      Any process that activates or increases the frequency, rate or extent of membrane protein ectodomain peptidolysis.

    Protein Sequence

    >Q91X43
MNIMNTEQSQNTIVSRIKAFEGQTNTEIPGLPKKPEIIPRTIPPKPAVSSGKPLVAPKPAANRASGEWDTWAENRLKVTS
REGLTPYSSPQEAGITPVTKPELPKKPTPGLTRSVNHETSGGRPMAESPDTGKKIPTPAPRPLLPKKSASTDAPPYPSIP
PKLVSAPPRLSVASQAKAFRSLGEGLPSNPPVPAPQSKALGDIDLISFDDDVLPTSGSPAEEPTGSETVLDPFQLPTKTE
ATKERAVQPAPTRKPTVIRIPAKPGKCLHEEPQSPPPLPAEKPVGNTHSAVSGRPSHSDRTRNPELEQASESGGLVQGPP
RLPPRPVHGKVIPVWRPPPKGAPERPPPPKLPASKSSNKNLPFNRSSSDMDLQKKQSHFVSGLSKAKSQIFKNQDPVLPP
RPKPGHPLYRKYMLSVPHGIANEDIVSRNPTELSCKRGDVLVILKQAENNYLECQRGEGTGRVHPSQMKIVTPLDERPRG
RPNDSGHSQKPVDSGAPHAVALHDFPAEQADDLSLTSGEIVYLLEKIDAEWYRGKCRNQTGVFPANYVKVIVDIPEGRSG
KRESFSSHCAKGPRCVARFEYIGDQKDELSFSEGEVIILTEYVNEEWGRGEIRDRSGIFPLNFVELVGDHPTSGANILST
KVPPKTKNEDPGSNSQDSSPPGEWCKALHSFTAETSEDLPFKRGDRILILERLDSDWYRGRLHDREGIFPAVFVQPCPAE
AKGVASAIPKGRKVKALYDFLGENEDELSFKAGDVITELEPIDDAWMRGELMGRAGMFPKNYVQFLQVS