gap-3 GTPase Activating Protein family
UniProt Data
Accession | Q95XA9 [ UniProt ] |
Name | Q95XA9_CAEEL |
Description | GTPase Activating Protein family |
Species | Caenorhabditis elegans |
Sequence Length | 928 |
Enzyme Annotations (0)
GO Annotations
Cellular component (1)
None predictedMolecular function (1)
None predictedBiological process (7)
- GO:0007614 Short-term memory
The memory process that deals with the storage, retrieval and modification of information received a short time (up to about 30 minutes) ago. This type of memory is typically dependent on direct, transient effects of second messenger activation. - GO:0007614 Short-term memory
The memory process that deals with the storage, retrieval and modification of information received a short time (up to about 30 minutes) ago. This type of memory is typically dependent on direct, transient effects of second messenger activation. - GO:0007616 Long-term memory
The memory process that deals with the storage, retrieval and modification of information a long time (typically weeks, months or years) after receiving that information. This type of memory is typically dependent on gene transcription regulated by second messenger activation. - GO:0007616 Long-term memory
The memory process that deals with the storage, retrieval and modification of information a long time (typically weeks, months or years) after receiving that information. This type of memory is typically dependent on gene transcription regulated by second messenger activation. - GO:0007635 Chemosensory behavior
Behavior that is dependent upon the sensation of chemicals. - GO:0008306 Associative learning
Learning by associating a stimulus (the cause) with a particular outcome (the effect). - GO:0043409 Negative regulation of MAPK cascade
Any process that stops, prevents, or reduces the frequency, rate or extent of signal transduction mediated by the MAPKKK cascade.
Protein Sequence
>Q95XA9 MHSSENTTPNSSTEGPLFLKTHTNPTPPDISPNDVWYHGELNEHDANHLLQGTSPGAFLVRQTGQTRFYLSILDQDGYPK HLPIRQLTPPHYFFEGKRFETLRDIVDAYQLAVIPVRKGGIMPINGEIQETKYLCVRRFEQREIDEMNSEIGDILSVCET DETGWMLGRNETSGSVGIILRSHLEPLITEVADLSDLPYFYDTVSTDMVQYSPIGTFLLRRSSKGTDTYALLVKTQFDLV EKFLIVGCPSRGFSLAGRPFPTIGHVLTRYCDRAISGGVRLTHAVCVKHQRKSSSRRSTAEVRWPPFIGNETASMSSSQY DDGLREQKPRRMFRGTSIDTALASSSSFLTSSTAMPSPSTTVSTGIPEHLIDRFHDEDVNNHPETSSSTTTVAATVALRK SREEKQWKECWLTLSDIPGGSSQLSVFDSMGSKLRQQVDLSTCTLFWLDESVFCADGCLFLSPSFPQQQPPTLYLCFRPY TAFLKWIRILRSRTIYQDVPPPMLQGTISVGEPNSQVSILSIEIDKFRSELLKSDMFYSAQVSLNGVKIGVSNAFAPAGN KGPNEMPVVVIDSKFVIPCIPTCSTNIQLSMNSHSSIGKRGRPCGVTVTICLNENNESICQSQADSTGFVFRAQRNRCPV LPLDRYKPLLDMIRECPSSILSWPSQVLPSHLKQFMYTCISHLYALNPQFMSQVIRRIINDILVTSTAEDVFRKDSLATG IITQCLRHLFKTPFDEFLLENAQFSQSLKQQNLDSGGGAVELLVNFVDQRLLTIPLATRLLTIAAECAGCRFGDEQHEQH LIKRTLSALLILRVLNPIIFSTLNTGIGSQIAKLVQISANSAASQTPTDSLTPAASTIRRMFDRIIFLVNQQQPAESPED SEIGEVHTEWISCLTYMIGHSLTIRSATSSEDVHLPLPVLELIRLHHL