SLA2 Src-like-adapter 2
UniProt Data
Accession | Q9H6Q3 [ UniProt ] |
Name | SLAP2_HUMAN |
Description | Src-like-adapter 2 |
Species | Homo sapiens |
Sequence Length | 261 |
Enzyme Annotations (0)
GO Annotations
Cellular component (6)
- GO:0005654 Nucleoplasm
That part of the nuclear content other than the chromosomes or the nucleolus. - GO:0005737 Cytoplasm
All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures. - GO:0005794 Golgi apparatus
A compound membranous cytoplasmic organelle of eukaryotic cells, consisting of flattened, ribosome-free vesicles arranged in a more or less regular stack. The Golgi apparatus differs from the endoplasmic reticulum in often having slightly thicker membranes, appearing in sections as a characteristic shallow semicircle so that the convex side (cis or entry face) abuts the endoplasmic reticulum, secretory vesicles emerging from the concave side (trans or exit face). In vertebrate cells there is usually one such organelle, while in invertebrates and plants, where they are known usually as dictyosomes, there may be several scattered in the cytoplasm. The Golgi apparatus processes proteins produced on the ribosomes of the rough endoplasmic reticulum; such processing includes modification of the core oligosaccharides of glycoproteins, and the sorting and packaging of proteins for transport to a variety of cellular locations. Three different regions of the Golgi are now recognized both in terms of structure and function: cis, in the vicinity of the cis face, trans, in the vicinity of the trans face, and medial, lying between the cis and trans regions. - GO:0005886 Plasma membrane
The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins. - GO:0010008 Endosome membrane
The lipid bilayer surrounding an endosome. - GO:0043231 Intracellular membrane-bounded organelle
Organized structure of distinctive morphology and function, bounded by a single or double lipid bilayer membrane and occurring within the cell. Includes the nucleus, mitochondria, plastids, vacuoles, and vesicles. Excludes the plasma membrane.
Molecular function (3)
- GO:0005070 SH3/SH2 adaptor activity
Interacting selectively and non-covalently and simultaneously with one or more signal transduction molecules, usually acting as a scaffold to bring these molecules into close proximity either using their own SH2/SH3 domains (e.g. Grb2) or those of their target molecules (e.g. SAM68). - GO:0005515 Protein binding
Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules). - GO:0047485 Protein N-terminus binding
Interacting selectively and non-covalently with a protein N-terminus, the end of any peptide chain at which the 2-amino (or 2-imino) function of a constituent amino acid is not attached in peptide linkage to another amino-acid residue.
Biological process (8)
- GO:0000122 Negative regulation of transcription from RNA polymerase II promoter
Any process that stops, prevents, or reduces the frequency, rate or extent of transcription from an RNA polymerase II promoter. - GO:0019724 B cell mediated immunity
Any process involved with the carrying out of an immune response by a B cell, through, for instance, the production of antibodies or cytokines, or antigen presentation to T cells. - GO:0030522 Intracellular receptor signaling pathway
Any series of molecular signals initiated by a ligand binding to an receptor located within a cell. - GO:0042110 T cell activation
The change in morphology and behavior of a mature or immature T cell resulting from exposure to a mitogen, cytokine, chemokine, cellular ligand, or an antigen for which it is specific. - GO:0050776 Regulation of immune response
Any process that modulates the frequency, rate or extent of the immune response, the immunological reaction of an organism to an immunogenic stimulus. - GO:0050849 Negative regulation of calcium-mediated signaling
Any process that stops, prevents, or reduces the frequency, rate or extent of calcium-mediated signaling. - GO:0050851 Antigen receptor-mediated signaling pathway
A series of molecular signals initiated by the cross-linking of an antigen receptor on a B or T cell. - GO:0050869 Negative regulation of B cell activation
Any process that stops, prevents, or reduces the frequency, rate or extent of B cell activation.
Protein Sequence
>Q9H6Q3 MGSLPSRRKSLPSPSLSSSVQGQGPVTMEAERSKATAVALGSFPAGGPAELSLRLGEPLTIVSEDGDWWTVLSEVSGREY NIPSVHVAKVSHGWLYEGLSREKAEELLLLPGNPGGAFLIRESQTRRGSYSLSVRLSRPASWDRIRHYRIHCLDNGWLYI SPRLTFPSLQALVDHYSELADDICCLLKEPCVLQRAGPLPGKDIPLPVTVQRTPLNWKELDSSLLFSEAATGEESLLSEG LRESLSFYISLNDEAVSLDDA