ced-2 Cell death abnormality protein 2
UniProt Data
Accession | Q9NHC3 [ UniProt ] |
Name | CED2_CAEEL |
Description | Cell death abnormality protein 2 |
Species | Caenorhabditis elegans |
Sequence Length | 279 |
Enzyme Annotations (0)
GO Annotations
Cellular component (1)
None predictedMolecular function (3)
- GO:0005070 SH3/SH2 adaptor activity
Interacting selectively and non-covalently and simultaneously with one or more signal transduction molecules, usually acting as a scaffold to bring these molecules into close proximity either using their own SH2/SH3 domains (e.g. Grb2) or those of their target molecules (e.g. SAM68). - GO:0005515 Protein binding
Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules). - GO:0032403 Protein complex binding
Interacting selectively and non-covalently with any protein complex (a complex of two or more proteins that may include other nonprotein molecules).
Biological process (9)
- GO:0006915 Apoptotic process
A programmed cell death process which begins when a cell receives an internal (e.g. DNA damage) or external signal (e.g. an extracellular death ligand), and proceeds through a series of biochemical events (signaling pathway phase) which trigger an execution phase. The execution phase is the last step of an apoptotic process, and is typically characterized by rounding-up of the cell, retraction of pseudopodes, reduction of cellular volume (pyknosis), chromatin condensation, nuclear fragmentation (karyorrhexis), plasma membrane blebbing and fragmentation of the cell into apoptotic bodies. When the execution phase is completed, the cell has died. - GO:0007165 Signal transduction
The cellular process in which a signal is conveyed to trigger a change in the activity or state of a cell. Signal transduction begins with reception of a signal (e.g. a ligand binding to a receptor or receptor activation by a stimulus such as light), or for signal transduction in the absence of ligand, signal-withdrawal or the activity of a constitutively active receptor. Signal transduction ends with regulation of a downstream cellular process, e.g. regulation of transcription or regulation of a metabolic process. Signal transduction covers signaling from receptors located on the surface of the cell and signaling via molecules located within the cell. For signaling between cells, signal transduction is restricted to events at and within the receiving cell. - GO:0012501 Programmed cell death
A process which begins when a cell receives an internal or external signal and activates a series of biochemical events (signaling pathway). The process ends with the death of the cell. - GO:0016477 Cell migration
The controlled self-propelled movement of a cell from one site to a destination guided by molecular cues. Cell migration is a central process in the development and maintenance of multicellular organisms. - GO:0031532 Actin cytoskeleton reorganization
A process that is carried out at the cellular level which results in dynamic structural changes to the arrangement of constituent parts of cytoskeletal structures comprising actin filaments and their associated proteins. - GO:0043652 Engulfment of apoptotic cell
The removal of the apoptotic cell by phagocytosis, by a neighboring cell or by a phagocyte. - GO:1901076 Positive regulation of engulfment of apoptotic cell
Any process that activates or increases the frequency, rate or extent of engulfment of apoptotic cell. - GO:1902742 Apoptotic process involved in development
Any apoptotic process that is involved in anatomical structure development. - GO:1903356 Positive regulation of distal tip cell migration
Any process that activates or increases the frequency, rate or extent of distal tip cell migration.
Protein Sequence
>Q9NHC3 MTTNGFDPFEWRSFYFPGMSREEAHKLLGEPQVSIGTFLMRDSSRPGEYSLTVREADEGNAVCHYLIERGEPKEDGTAAA GVKIANQSFPDIPALLNHFKMRVLTEASLLAAYKKPIIEVVVGTFKFTGERETDLPFEQGERLEILSKTNQDWWEARNAL GTTGLVPANYVQIQMEFHNDRTSKGASQSSIGSSGGGAERFSSASTSSDNIELQPRLPAKAKVTFDRVPNAYDPTQLRVK KGQTVLVTQKMSNGMYKAELDGQIGSVPHTYLRFTAVSE