app1 Protein app1
UniProt Data
Accession | Q9P7E8 [ UniProt ] |
Name | APP1_SCHPO |
Description | Protein app1 |
Species | Schizosaccharomyces pombe 972h- |
Sequence Length | 857 |
Enzyme Annotations (0)
GO Annotations
Cellular component (4)
- GO:0030479 Actin cortical patch
An endocytic patch that consists of an actin-containing structure found at the plasma membrane in cells; formed of networks of branched actin filaments that lie just beneath the plasma membrane and assemble, move, and disassemble rapidly. An example of this is the actin cortical patch found in Saccharomyces cerevisiae. - GO:0032153 Cell division site
The eventual plane of cell division (also known as cell cleavage or cytokinesis) in a dividing cell. In Eukaryotes, the cleavage apparatus, composed of septin structures and the actomyosin contractile ring, forms along this plane, and the mitotic, or meiotic, spindle is aligned perpendicular to the division plane. In bacteria, the cell division site is generally located at mid-cell and is the site at which the cytoskeletal structure, the Z-ring, assembles. - GO:0051286 Cell tip
The region at the end of the longest axis of a cylindrical or elongated cell. - GO:0099079 Actin body
An amorphous cytoskeletal structure consisting of aggregated actin filaments and associated proteins (including fibrin and capping protein) in which there is little or no actin filament turnover. In yeast (S. pombe and S. cerevisiae) these are found only in quiescent cells and are thought to serve as a reserve store of actin.
Molecular function (1)
None predictedBiological process (1)
None predictedProtein Sequence
>Q9P7E8 MSFQLDTSTHGAEIRNVYEKVLSGADDCSWAIFGYEKGQGNILKVVASGNDNDEFLDEFDENAVLFGFLRVKDVNTGLNK FVLVCWCGEAAARKGLFSIHMATVSNLLKGYHVQITGRESSDLNMDDIIRRVADASGSKYSVHTSNSTPQSKHNAFYDAS QTFGSTAKVAPAPAPSTKTPLANISKPVVQAQKDSKDNSWDDSSKQSNTQTANTTSNLRVPVNASWSDAGRKEKSQENKP KPTPFGSGGPSKPTPFESHGPAKQISVQPSEHPKPSISTTTTGSSYRSAESSHAPTTPDHFKLTPLTKLEPQPPSGSPSK KPVSELEELHTAGNVNLSARRALFEKKESSTKNVENPVSHHLKSPVRTSFPPASTTASKQDSPSTVPVDKQETAKPINKQ VSSNETSAQEEPRESVAALRARFAKANVSENNDPPTFPKTAAKISSFNSKAGTSFAKPRPFTNNPNPISAPEKPTSGESL SLNPPPAMPKVFPERDISSASQKAAQPSVITPSVPQPPAAPVVPEAPSVHQPPAAPVAPEVPSAPQRPAAPVVPEAPSVP QRPAVPVVPEALSVPQPPVAPVAPEVPSVPQPPVAPVVPEAPSVPQPPVAPVAPEVPSVPQRPAVPVVPEAPSVPQPPAA PVVPEVPSVPQRPAVPVVPEAPSVPQPPAAPVVPEVPSVPQPPAVPVVPEAGQLNEPVVPPLPPHDETQEPQVGGDVKAT EHTQPTKTPAIVIYDYSPEEENEIELVENEQIQILEFVDDGWWLGENSKGQQGLFPSNYVEITGPNETANNPPAEPQAGG PGKSVKAIYDYQAQEDNELSFFEDEIIANVDCVDPNWWEGECHGHRGLFPSNYVEEI