Trp53inp1 Tumor protein p53-inducible nuclear protein 1
UniProt Data
Accession | Q9QXE4 [ UniProt ] |
Name | T53I1_MOUSE |
Description | Tumor protein p53-inducible nuclear protein 1 |
Species | Mus musculus |
Sequence Length | 239 |
Enzyme Annotations (0)
GO Annotations
Cellular component (6)
- GO:0005634 Nucleus
A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent. - GO:0005634 Nucleus
A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent. - GO:0005776 Autophagosome
A double-membrane-bounded compartment that engulfs endogenous cellular material as well as invading microorganisms to target them to the vacuole/lysosome for degradation as part of macroautophagy. - GO:0005776 Autophagosome
A double-membrane-bounded compartment that engulfs endogenous cellular material as well as invading microorganisms to target them to the vacuole/lysosome for degradation as part of macroautophagy. - GO:0005829 Cytosol
The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes. - GO:0005829 Cytosol
The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
Molecular function (1)
None predictedBiological process (20)
- GO:0007050 Cell cycle arrest
A regulatory process that halts progression through the cell cycle during one of the normal phases (G1, S, G2, M). - GO:0008285 Negative regulation of cell proliferation
Any process that stops, prevents or reduces the rate or extent of cell proliferation. - GO:0009408 Response to heat
Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a heat stimulus, a temperature stimulus above the optimal temperature for that organism. - GO:0010508 Positive regulation of autophagy
Any process that activates, maintains or increases the rate of autophagy. Autophagy is the process in which cells digest parts of their own cytoplasm. - GO:0010508 Positive regulation of autophagy
Any process that activates, maintains or increases the rate of autophagy. Autophagy is the process in which cells digest parts of their own cytoplasm. - GO:0010628 Positive regulation of gene expression
Any process that increases the frequency, rate or extent of gene expression. Gene expression is the process in which a gene's coding sequence is converted into a mature gene product or products (proteins or RNA). This includes the production of an RNA transcript as well as any processing to produce a mature RNA product or an mRNA (for protein-coding genes) and the translation of that mRNA into protein. Protein maturation is included when required to form an active form of a product from an inactive precursor form. - GO:0010629 Negative regulation of gene expression
Any process that decreases the frequency, rate or extent of gene expression. Gene expression is the process in which a gene's coding sequence is converted into a mature gene product or products (proteins or RNA). This includes the production of an RNA transcript as well as any processing to produce a mature RNA product or an mRNA (for protein-coding genes) and the translation of that mRNA into protein. Protein maturation is included when required to form an active form of a product from an inactive precursor form. - GO:0030336 Negative regulation of cell migration
Any process that stops, prevents, or reduces the frequency, rate or extent of cell migration. - GO:0034644 Cellular response to UV
Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an ultraviolet radiation (UV light) stimulus. Ultraviolet radiation is electromagnetic radiation with a wavelength in the range of 10 to 380 nanometers. - GO:0043065 Positive regulation of apoptotic process
Any process that activates or increases the frequency, rate or extent of cell death by apoptotic process. - GO:0045893 Positive regulation of transcription, DNA-templated
Any process that activates or increases the frequency, rate or extent of cellular DNA-templated transcription. - GO:0045893 Positive regulation of transcription, DNA-templated
Any process that activates or increases the frequency, rate or extent of cellular DNA-templated transcription. - GO:0048102 Autophagic cell death
A form of programmed cell death that is accompanied by the formation of autophagosomes. Autophagic cell death is characterized by lack of chromatin condensation and massive vacuolization of the cytoplasm, with little or no uptake by phagocytic cells. - GO:0048102 Autophagic cell death
A form of programmed cell death that is accompanied by the formation of autophagosomes. Autophagic cell death is characterized by lack of chromatin condensation and massive vacuolization of the cytoplasm, with little or no uptake by phagocytic cells. - GO:0048147 Negative regulation of fibroblast proliferation
Any process that stops, prevents, or reduces the frequency, rate or extent of multiplication or reproduction of fibroblast cells. - GO:0071361 Cellular response to ethanol
Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an ethanol stimulus. - GO:0071447 Cellular response to hydroperoxide
Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a hydroperoxide stimulus. Hydroperoxides are monosubstitution products of hydrogen peroxide, HOOH. - GO:0072703 Cellular response to methyl methanesulfonate
Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a methyl methanesulfonate (MMS) stimulus. - GO:1904761 Negative regulation of myofibroblast differentiation
Any process that stops, prevents or reduces the frequency, rate or extent of myofibroblast differentiation. - GO:2001235 Positive regulation of apoptotic signaling pathway
Any process that activates or increases the frequency, rate or extent of apoptotic signaling pathway.
Protein Sequence
>Q9QXE4 MFQRLNKMFVGEVTTSSSQEPEFSEKEDDEWILVDFIDTCPGFSAEEEEEDEDIGEESSAEHTSVFSCLPASLECLTDTS DSCFLQFESCPMEESWFITPPPCFTAGGLTTIKVETSPMENLLIEHPSMSVYAVHNSCPGLSEASCGNDEYNSSGPRMEA QSEMGKHIHCCVAALAAQATFLEQPKSFRPSQWIKGHSERQSLNRNGLRRQNLTRDCHTRQMKHSGWVVHQPCPRQYNY