Vav3 Guanine nucleotide exchange factor VAV3

• Overview
• Annotations

UniProt Data

Enzyme Annotations (0)

GO Annotations

Cellular component (3)

• GO:0005737 Cytoplasm
  All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
• GO:0005886 Plasma membrane
  The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
• GO:0070062 Extracellular exosome
  A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.

Molecular function (6)

• GO:0005085 Guanyl-nucleotide exchange factor activity
  Stimulates the exchange of guanyl nucleotides associated with a GTPase. Under normal cellular physiological conditions, the concentration of GTP is higher than that of GDP, favoring the replacement of GDP by GTP in association with the GTPase.
• GO:0005085 Guanyl-nucleotide exchange factor activity
  Stimulates the exchange of guanyl nucleotides associated with a GTPase. Under normal cellular physiological conditions, the concentration of GTP is higher than that of GDP, favoring the replacement of GDP by GTP in association with the GTPase.
• GO:0005089 Rho guanyl-nucleotide exchange factor activity
  Stimulates the exchange of guanyl nucleotides associated with a GTPase of the Rho family. Under normal cellular physiological conditions, the concentration of GTP is higher than that of GDP, favoring the replacement of GDP by GTP in association with the GTPase.
• GO:0005154 Epidermal growth factor receptor binding
  Interacting selectively and non-covalently with the epidermal growth factor receptor.
• GO:0005515 Protein binding
  Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
• GO:0030676 Rac guanyl-nucleotide exchange factor activity
  Stimulates the exchange of guanyl nucleotides associated with a GTPase of the Rac family. Under normal cellular physiological conditions, the concentration of GTP is higher than that of GDP, favoring the replacement of GDP by GTP in association with the GTPase.

Biological process (15)

• GO:0006906 Vesicle fusion
  Fusion of the membrane of a transport vesicle with its target membrane.
• GO:0006974 Cellular response to DNA damage stimulus
  Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus indicating damage to its DNA from environmental insults or errors during metabolism.
• GO:0007229 Integrin-mediated signaling pathway
  A series of molecular signals initiated by the binding of extracellular ligand to an integrin on the surface of a target cell, and ending with regulation of a downstream cellular process, e.g. transcription.
• GO:0007264 Small GTPase mediated signal transduction
  Any series of molecular signals in which a small monomeric GTPase relays one or more of the signals.
• GO:0016477 Cell migration
  The controlled self-propelled movement of a cell from one site to a destination guided by molecular cues. Cell migration is a central process in the development and maintenance of multicellular organisms.
• GO:0030031 Cell projection assembly
  Formation of a prolongation or process extending from a cell, e.g. a flagellum or axon.
• GO:0030032 Lamellipodium assembly
  Formation of a lamellipodium, a thin sheetlike extension of the surface of a migrating cell.
• GO:0030593 Neutrophil chemotaxis
  The directed movement of a neutrophil cell, the most numerous polymorphonuclear leukocyte found in the blood, in response to an external stimulus, usually an infection or wounding.
• GO:0030890 Positive regulation of B cell proliferation
  Any process that activates or increases the rate or extent of B cell proliferation.
• GO:0042493 Response to drug
  Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a drug stimulus. A drug is a substance used in the diagnosis, treatment or prevention of a disease.
• GO:0043087 Regulation of GTPase activity
  Any process that modulates the rate of GTP hydrolysis by a GTPase.
• GO:0043087 Regulation of GTPase activity
  Any process that modulates the rate of GTP hydrolysis by a GTPase.
• GO:0043552 Positive regulation of phosphatidylinositol 3-kinase activity
  Any process that activates or increases the frequency, rate or extent of phosphatidylinositol 3-kinase activity.
• GO:0045785 Positive regulation of cell adhesion
  Any process that activates or increases the frequency, rate or extent of cell adhesion.
• GO:0050853 B cell receptor signaling pathway
  A series of molecular signals initiated by the cross-linking of an antigen receptor on a B cell.

Protein Sequence

>Q9R0C8
MEPWKQCAQWLIHSKVLPPNHRVTWDSAQVFDLAQTLRDGVLLCQLLNNLRPHSINLKEINLRPQMSQFLCLKNIRTFLA
ACCDTFGMRKSELFEAFDLFDVRDFGKVIETLSRLSRTPIALATGIRPFPTEESINDEDIYKGLPDLIDETRVEDEEDLY
DCVYGEDEGGEVYEDLMKAEEAQQPKSQENDIRSCCLAEIRQTEEKYTETLESIEKYFMAPLKRFLTAAEFDSVFINIPD
LVKVHRSLMQEIHDSIVNKDDQNLYQVFINYKERLVIYGQYCSGVESAISNLDYISKTKEDVKLKLEECSKRANNGKFTL
RDLLVVPMQRVLKYHLLLQELVKHTHDPMEKANLKLALDAMKDLAQYVNEVKRDNETLREIKQFQLSIENLNQPVLLFGR
PQGDGEIRITTLDKHTKQERHIFLFDLAVIVCKRKGDNYEMKEIIDLQQYKIANNPTTDKENKKWSYGFYLIHTQGQNGL
EFYCKTKDLKKKWLEQFEMALSNIRPDYADSNFHDFKMHTFTRVTSCRVCQMLLRGTFYQGYLCFKCGAKAHKECLGRVD
NCGRVNSVEQGPFKPPEKRTNGLRRASRQVDPGLPKMQVIRNYTGTPAPGLHEGPPLHIQAGDTVELLRGDAHSVFWQGR
NLASGEVGFFPSDAVKPSPCVPKPVDYSCQPWYAGPMERLQAETELINRVNSTYLVRHRTKESGEYAISIKYNNEAKHIK
ILTRDGFFHIAENRKFKSLMELVEYYKHHSLKEGFRTLDTTLQFPYKEPEQPAGQRGNRTGNSLLSPKVLGIAIARYDFC
ARDMRELSLLKGDMVKIYTKMSANGWWRGEVNGRVGWFPSTYVEEDE