Src42A Tyrosine-protein kinase Src42A
UniProt Data
Accession | Q9V9J3 [ UniProt ] |
Name | SRC42_DROME |
Description | Tyrosine-protein kinase Src42A |
Species | Drosophila melanogaster |
Sequence Length | 517 |
Enzyme Annotations (1)
- EC:2.7.10.2 Non-specific protein-tyrosine kinase.
ATP + a [protein]-L-tyrosine = ADP + a [protein]-L-tyrosine phosphate.
GO Annotations
Cellular component (3)
- GO:0005737 Cytoplasm
All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures. - GO:0005886 Plasma membrane
The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins. - GO:0005912 Adherens junction
A cell junction at which anchoring proteins (cadherins or integrins) extend through the plasma membrane and are attached to actin filaments.
Molecular function (2)
- GO:0004713 Protein tyrosine kinase activity
Catalysis of the reaction: ATP + a protein tyrosine = ADP + protein tyrosine phosphate. - GO:0004713 Protein tyrosine kinase activity
Catalysis of the reaction: ATP + a protein tyrosine = ADP + protein tyrosine phosphate.
Biological process (27)
- GO:0006099 Tricarboxylic acid cycle
A nearly universal metabolic pathway in which the acetyl group of acetyl coenzyme A is effectively oxidized to two CO2 and four pairs of electrons are transferred to coenzymes. The acetyl group combines with oxaloacetate to form citrate, which undergoes successive transformations to isocitrate, 2-oxoglutarate, succinyl-CoA, succinate, fumarate, malate, and oxaloacetate again, thus completing the cycle. In eukaryotes the tricarboxylic acid is confined to the mitochondria. See also glyoxylate cycle. - GO:0006468 Protein phosphorylation
The process of introducing a phosphate group on to a protein. - GO:0006468 Protein phosphorylation
The process of introducing a phosphate group on to a protein. - GO:0006468 Protein phosphorylation
The process of introducing a phosphate group on to a protein. - GO:0007169 Transmembrane receptor protein tyrosine kinase signaling pathway
A series of molecular signals initiated by the binding of an extracellular ligand to a receptor on the surface of the target cell where the receptor possesses tyrosine kinase activity, and ending with regulation of a downstream cellular process, e.g. transcription. - GO:0007254 JNK cascade
An intracellular protein kinase cascade containing at least a JNK (a MAPK), a JNKK (a MAPKK) and a JUN3K (a MAP3K). The cascade can also contain two additional tiers: the upstream MAP4K and the downstream MAP Kinase-activated kinase (MAPKAPK). The kinases in each tier phosphorylate and activate the kinases in the downstream tier to transmit a signal within a cell. - GO:0007391 Dorsal closure
The process during Drosophila embryogenesis whereby the ectodermal cells of the lateral epithelium stretch in a coordinated fashion to internalize the amnioserosa cells and close the embryo dorsally. - GO:0007391 Dorsal closure
The process during Drosophila embryogenesis whereby the ectodermal cells of the lateral epithelium stretch in a coordinated fashion to internalize the amnioserosa cells and close the embryo dorsally. - GO:0007391 Dorsal closure
The process during Drosophila embryogenesis whereby the ectodermal cells of the lateral epithelium stretch in a coordinated fashion to internalize the amnioserosa cells and close the embryo dorsally. - GO:0007395 Dorsal closure, spreading of leading edge cells
Dorsally-directed movement of a cell at the leading edge of the epithelium over the amnioserosa. - GO:0007411 Axon guidance
The chemotaxis process that directs the migration of an axon growth cone to a specific target site in response to a combination of attractive and repulsive cues. - GO:0007424 Open tracheal system development
The process whose specific outcome is the progression of an open tracheal system over time, from its formation to the mature structure. An open tracheal system is a respiratory system, a branched network of epithelial tubes that supplies oxygen to target tissues via spiracles. An example of this is found in Drosophila melanogaster. - GO:0007435 Salivary gland morphogenesis
The process in which the anatomical structures of the salivary gland are generated and organized. - GO:0007476 Imaginal disc-derived wing morphogenesis
The process in which the anatomical structures of the imaginal disc-derived wing are generated and organized. The wing is an appendage modified for flying. - GO:0016477 Cell migration
The controlled self-propelled movement of a cell from one site to a destination guided by molecular cues. Cell migration is a central process in the development and maintenance of multicellular organisms. - GO:0018108 Peptidyl-tyrosine phosphorylation
The phosphorylation of peptidyl-tyrosine to form peptidyl-O4'-phospho-L-tyrosine. - GO:0034332 Adherens junction organization
A process that is carried out at the cellular level which results in the assembly, arrangement of constituent parts, or disassembly of an adherens junction. An adherens junction is a cell junction at which the cytoplasmic face of the plasma membrane is attached to actin filaments. - GO:0036335 Intestinal stem cell homeostasis
Any biological process involved in the maintenance of the steady-state number of intestinal stem cells within a population of cells. - GO:0042059 Negative regulation of epidermal growth factor receptor signaling pathway
Any process that stops, prevents, or reduces the frequency, rate or extent of epidermal growth factor receptor signaling pathway activity. - GO:0042742 Defense response to bacterium
Reactions triggered in response to the presence of a bacterium that act to protect the cell or organism. - GO:0043277 Apoptotic cell clearance
The recognition and removal of an apoptotic cell by a neighboring cell or by a phagocyte. - GO:0045886 Negative regulation of synaptic growth at neuromuscular junction
Any process that stops, prevents, or reduces the frequency, rate or extent of synaptic growth at neuromuscular junction. - GO:0046529 Imaginal disc fusion, thorax closure
The joining of the parts of the wing imaginal discs, giving rise to the adult thorax. - GO:0048167 Regulation of synaptic plasticity
A process that modulates synaptic plasticity, the ability of synapses to change as circumstances require. They may alter function, such as increasing or decreasing their sensitivity, or they may increase or decrease in actual numbers. - GO:0048749 Compound eye development
The process whose specific outcome is the progression of the compound eye over time, from its formation to the mature structure. The compound eye is an organ of sight that contains multiple repeating units, often arranged hexagonally. Each unit has its own lens and photoreceptor cell(s) and can generate either a single pixelated image or multiple images, per eye. - GO:0051017 Actin filament bundle assembly
The assembly of actin filament bundles; actin filaments are on the same axis but may be oriented with the same or opposite polarities and may be packed with different levels of tightness. - GO:0090136 Epithelial cell-cell adhesion
The attachment of an epithelial cell to another epithelial cell via adhesion molecules.
Protein Sequence
>Q9V9J3 MGNCLTTQKGEPDKPADRIKLDDPPTIGVGVGVPQIPMPSHAGQPPEQIRPVPQIPESETAGANAKIFVALYDYDARTDE DLSFRKGEHLEILNDTQGDWWLARSKKTRSEGYIPSNYVAKLKSIEAEPWYFRKIKRIEAEKKLLLPENEHGAFLIRDSE SRHNDYSLSVRDGDTVKHYRIRQLDEGGFFIARRTTFRTLQELVEHYSKDSDGLCVNLCKPCVQIEKPVTEGLSHRTRDQ WEIDRTSLKFVRKLGSGQFGDVWEGLWNNTTPVAIKTLKSGTMDPKDFLAEAQIMKKLRHTKLIQLYAVCTVEEPIYIIT ELMKHGSLLEYLQAIAGKGRSLKMQTLIDMAAQIAAGMAYLESQNYIHRDLAARNVLVGDGNIVKIADFGLARLIKEDEY EARVGARFPIKWTAPEAANYSKFSIKSDVWSFGILLTELVTYGRIPYPGMTNAEVLTQVEHGYRMPQPPNCEPRLYEIML ECWHKDPMRRPTFETLQWKLEDFYTSDQSDYKEAQAY