Genome3D
Caenorhabditis elegans

toca-2 Transducer of Cdc42-dependent actin assembly protein 2 homolog

UniProt Data

Accession Q9XUS7 [ UniProt ]
Name TOCA2_CAEEL
Description Transducer of Cdc42-dependent actin assembly protein 2 homolog
Species Caenorhabditis elegans
Sequence Length610

Enzyme Annotations (0)

    GO Annotations

    Cellular component (4)

    • GO:0005737 Cytoplasm
      All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    • GO:0005886 Plasma membrane
      The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
    • GO:0005911 Cell-cell junction
      A cell junction that forms a connection between two or more cells in a multicellular organism; excludes direct cytoplasmic junctions such as ring canals.
    • GO:0097708 Intracellular vesicle
      Any vesicle that is part of the intracellular region.

    Molecular function (1)

    None predicted

    Biological process (8)

    • GO:0032956 Regulation of actin cytoskeleton organization
      Any process that modulates the frequency, rate or extent of the formation, arrangement of constituent parts, or disassembly of cytoskeletal structures comprising actin filaments and their associated proteins.
    • GO:0048613 Embryonic ectodermal digestive tract morphogenesis
      The process, occurring during the embryonic phase, by which the anatomical structures of the ectodermal digestive tract are generated and organized.
    • GO:0048613 Embryonic ectodermal digestive tract morphogenesis
      The process, occurring during the embryonic phase, by which the anatomical structures of the ectodermal digestive tract are generated and organized.
    • GO:1901046 Positive regulation of oviposition
      Any process that activates or increases the frequency, rate or extent of oviposition.
    • GO:1901046 Positive regulation of oviposition
      Any process that activates or increases the frequency, rate or extent of oviposition.
    • GO:1904703 Negative regulation of protein localization to cell-cell adherens junction
      Any process that stops, prevents or reduces the frequency, rate or extent of protein localization to cell-cell adherens junction.
    • GO:2000370 Positive regulation of clathrin-dependent endocytosis
      Any process that activates or increases the frequency, rate or extent of clathrin-mediated endocytosis.
    • GO:2000370 Positive regulation of clathrin-dependent endocytosis
      Any process that activates or increases the frequency, rate or extent of clathrin-mediated endocytosis.

    Protein Sequence

    >Q9XUS7
MIPVSRFFTVQDPSNALLSYTQKGIDFFEKLGQFSKEKAAIEEEYSTKLRSLAKKYAKKSEEDDEILKSVSYTSSFNSFL
QQLDQIATRHQTSAEHIRGGVVSYVASKTCQMRSSRKNAINDLKTINDKLEDQINEMCKSGKCYLKSFKDAENSYQKFYK
ADKNLEISRLELEKARALANARNEACELAKQDYSALVRKTNAEQKRYHVELLPVIFARLKAVDKECIADMRQVLQKIVSF
DDSLADSTEECRKIMQREVGKIDAEGDAQLVLKSVEATIEQPAPFEIEDLGDPKNCDSRTNDSADGSGGKLLKSSPSKNR
IIRNFLGILKEKEADEKPEASNNDQLMYTDKSKPAHVRLSCLRSKIRDMEKQLEQAIQGREGITRLQQAYYTNPQHGNPS
ACTEPLISYAKKIEKLKMDIHNLKEFYAMLEMSVEEGQERSFGGRDTPDTTRSMSGSSTNQSSSKTIEDVLSGEAGNSSS
ADDSSKNILRQLFTTPKRLISSPKTSKSSTPTPLRRRAEISSPKILRSSFSGAIRKSLSTPDSVKVETAVTVTALFEFAK
SSAETMSIEQGEILLVLEHDHGDGWTRTKNCRKHNEESGFVPTSYLQFPQ