Crk Adapter molecule Crk

• Overview
• Annotations

UniProt Data

Enzyme Annotations (0)

GO Annotations

Cellular component (1)

Molecular function (2)

• GO:0005070 SH3/SH2 adaptor activity
  Interacting selectively and non-covalently and simultaneously with one or more signal transduction molecules, usually acting as a scaffold to bring these molecules into close proximity either using their own SH2/SH3 domains (e.g. Grb2) or those of their target molecules (e.g. SAM68).
• GO:0005515 Protein binding
  Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).

Biological process (8)

• GO:0006911 Phagocytosis, engulfment
  The internalization of bacteria, immune complexes and other particulate matter or of an apoptotic cell by phagocytosis, including the membrane and cytoskeletal processes required, which involves one of three mechanisms: zippering of pseudopods around a target via repeated receptor-ligand interactions, sinking of the target directly into plasma membrane of the phagocytosing cell, or induced uptake via an enhanced membrane ruffling of the phagocytosing cell similar to macropinocytosis.
• GO:0007298 Border follicle cell migration
  The directed movement of a border cell through the nurse cells to reach the oocyte. An example of this is found in Drosophila melanogaster.
• GO:0007520 Myoblast fusion
  A process in which non-proliferating myoblasts fuse to existing fibers or to myotubes to form new fibers. A myoblast is a mononucleate cell type that, by fusion with other myoblasts, gives rise to the myotubes that eventually develop into skeletal muscle fibers.
• GO:0032956 Regulation of actin cytoskeleton organization
  Any process that modulates the frequency, rate or extent of the formation, arrangement of constituent parts, or disassembly of cytoskeletal structures comprising actin filaments and their associated proteins.
• GO:0043087 Regulation of GTPase activity
  Any process that modulates the rate of GTP hydrolysis by a GTPase.
• GO:0046330 Positive regulation of JNK cascade
  Any process that activates or increases the frequency, rate or extent of signal transduction mediated by the JNK cascade.
• GO:0046529 Imaginal disc fusion, thorax closure
  The joining of the parts of the wing imaginal discs, giving rise to the adult thorax.
• GO:0048013 Ephrin receptor signaling pathway
  The series of molecular signals generated as a consequence of an ephrin receptor binding to an ephrin.

Protein Sequence

>Q9XYM0
MDTFDVSDRNSWYFGPMSRQDATEVLMNERERGVFLVRDSNSIAGDYVLCVREDTKVSNYIINKVQQQDQIVYRIGDQSF
DNLPKLLTFYTLHYLDTTPLKRPACRRVEKVIGKFDFVGSDQDDLPFQRGEVLTIVRKDEDQWWTARNSSGKIGQIPVPY
IQQYDDYMDEDAIDKNEPSISGSSNVFESTLKRTDLNRKLPAYARVKQSRVPNAYDKTALKLEIGDIIKVTKTNINGQWE
GELNGKNGHFPFTHVEFVDDCDLSKNSTEIC